Overview

  • Product name

    Anti-RPS18 antibody - C-terminal
    See all RPS18 primary antibodies
  • Description

    Rabbit polyclonal to RPS18 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human RPS18 aa 101-150 (C terminal). The exact sequence is proprietary. (NP_072045)
    Sequence:

    NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK


    Database link: P62269

  • Positive control

    • HepG2 Whole Cell lysates

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab186899 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.

Target

  • Function

    Located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.
  • Sequence similarities

    Belongs to the ribosomal protein S13P family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 40S ribosomal protein S18 antibody
    • HKE3 antibody
    • KE 3 antibody
    • Ke-3 antibody
    • Ke3 antibody
    • Rhabdomyosarcoma antigen MU-RMS-40.21 antibody
    • Ribosomal protein S18 antibody
    • rps18 antibody
    • RS18_HUMAN antibody
    see all

Images

  • Anti-RPS18 antibody - C-terminal (ab186899) at 1 µg/ml + HepG2 Whole Cell lysates at 10 µg

    Predicted band size: 18 kDa

References

ab186899 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186899.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up