Overview

  • Product name

    Anti-RPS19BP1/AROS antibody
    See all RPS19BP1/AROS primary antibodies
  • Description

    Rabbit polyclonal to RPS19BP1/AROS
  • Host species

    Rabbit
  • Specificity

    ab201091 detects endogenous levels of RPS19BP1/AROS protein.

  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide corresponding to Human RPS19BP1/AROS aa 84-129.
    Sequence:

    TVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKF

  • Positive control

    • HEK293T, RAW264.7 and H9C2 whole cell lysates.
  • General notes

     This product was previously labelled as RPS19BP1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab201091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 15 kDa.

Target

Images

  • All lanes : Anti-RPS19BP1/AROS antibody (ab201091)

    Lane 1 : HEK293T whole cell lysate
    Lane 2 : RAW264.7 whole cell lysate
    Lane 3 : H9C2 whole cell lysate

    Predicted band size: 15 kDa

References

This product has been referenced in:

  • Li J  et al. A comparative study of anti-aging properties and mechanism: resveratrol and caloric restriction. Oncotarget 8:65717-65729 (2017). Read more (PubMed: 29029466) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up