Overview

  • Product name

  • Description

    Rabbit polyclonal to RPS27A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Guinea pig, Cow
  • Immunogen

    Full length protein corresponding to Human RPS27A aa 1-156.
    Sequence:

    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQL EDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKL AVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCF NKPEDK


    Database link: NP_002945.1

  • Positive control

    • RPS27A transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 18 kDa.

Target

  • Relevance

    RPS27A (Ribosomal protein S27a) is a component of the 40S subunit of the ribosome. It is synthesized as a C-terminal extension protein (CEP) of ubiquitin. The fusion protein consists of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. The protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a.
  • Database links

  • Alternative names

    • 40S ribosomal protein S27a antibody
    • CEP 80 antibody
    • CEP80 antibody
    • HUBCEP 80 antibody
    • HUBCEP80 antibody
    • Ribosomal protein S27a antibody
    • RPS 27A antibody
    • UBA 80 antibody
    • UBA80 antibody
    • UBCEP 1 antibody
    • UBCEP 80 antibody
    • UBCEP1 antibody
    • UBCEP80 antibody
    • Ubiquitin 40S ribosomal protein S27a antibody
    • Ubiquitin and ribosomal protein S27a antibody
    • Ubiquitin carboxyl extension protein 80 antibody
    • Ubiquitin CEP80 antibody
    see all

Images

  • All lanes : Anti-RPS27A antibody (ab172293) at 1 µg/ml

    Lane 1 : RPS27A transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    Lane 1 : Goat anti-Rabbit IgG at 7500 mg/ml
    Lane 2 : Goat anti-Rabbit IgG at 1/7500 dilution

    Predicted band size: 18 kDa

References

ab172293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up