Overview

  • Product name

    Anti-RPS3A antibody - C-terminal
    See all RPS3A primary antibodies
  • Description

    Mouse polyclonal to RPS3A - C-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow, Cat, Xenopus laevis, Cynomolgus monkey, Xenopus tropicalis
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human RPS3A aa 164-263 (C terminal). (NP_000997).
    Sequence:

    IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVR KVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQES


    Database link: P61247

  • Positive control

    • HeLa, PC-12, Raw264.7 and NIH/3T3 cell lysates; Recombinant Human RPS3A protein (immunogen).

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 30 kDa.

Target

Images

  • Anti-RPS3A antibody - C-terminal (ab194670) at 1/500 dilution + NIH/3T3 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa

  • Anti-RPS3A antibody - C-terminal (ab194670) at 1/500 dilution + Raw264.7 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa

  • Anti-RPS3A antibody - C-terminal (ab194670) at 1/500 dilution + PC-12 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa

  • Anti-RPS3A antibody - C-terminal (ab194670) at 1/500 dilution + HeLa cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa

  • Anti-RPS3A antibody - C-terminal (ab194670) at 1/1000 dilution + Recombinant Human RPS3A protein (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 30 kDa



    Predicted MWt of immunogen: 37.11 kDa.

References

This product has been referenced in:

See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up