Overview

  • Product name

    Anti-RPS6KC1 antibody
  • Description

    Rabbit polyclonal to RPS6KC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RPS6KC1 aa 384-483.
    Sequence:

    VPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFLNRSPEESFDIKEV KKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSSQDD


    Database link: Q96S38

  • Positive control

    • ICC/IF: A431 cells. IHC-P: Human duodenum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May be involved in transmitting sphingosine-1 phosphate (SPP)-mediated signaling into the cell.
  • Tissue specificity

    Highly expressed in testis, skeletal muscle, brain, heart, placenta, kidney and liver and weakly expressed in thymus, small intestine, lung and colon.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. S6 kinase subfamily.
    Contains 1 MIT domain.
    Contains 2 protein kinase domains.
    Contains 1 PX (phox homology) domain.
  • Domain

    The first protein kinase domain appears to be a pseudokinase domain as it does not contain the classical characteristics, such as the ATP-binding motif, ATP-binding site and active site.
  • Cellular localization

    Cytoplasm. Membrane. Also found in some small dot-like or ring-shaped early endosome structures.
  • Information by UniProt
  • Database links

  • Alternative names

    • 52 kDa ribosomal protein S6 kinase antibody
    • humS6PKh1 antibody
    • KS6C1_HUMAN antibody
    • Ribosomal protein S6 kinase 52kD polypeptide 1 antibody
    • Ribosomal protein S6 kinase 52kDa polypeptide 1 antibody
    • Ribosomal protein S6 kinase C1 antibody
    • Ribosomal protein S6 kinase delta 1 antibody
    • Ribosomal protein S6 kinase delta-1 antibody
    • Ribosomal S6 kinase like protein with two PSK domains 118 kDa protein antibody
    • Ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein antibody
    • RPK 118 antibody
    • RPK118 antibody
    • RPS6KC1 antibody
    • RSKL1 antibody
    • S6K-delta-1 antibody
    • S6PKh1 antibody
    • SPHK1 binding protein antibody
    • SPHK1-binding protein antibody
    see all

Images

  • PFA-fixed/Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for RPS6KC1 (green) using ab224469 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human duodenum tissue stained for RPS6KC1 with ab224469 (1/20 dilution) in immunohistochemical analysis.

References

ab224469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up