Overview

  • Product name

    Anti-rpsB antibody
  • Description

    Rabbit polyclonal to rpsB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli rpsB aa 2-241.
    Sequence:

    ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFN EALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGML TNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGI KDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIP GNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE


    Database link: P0A7V0

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%,Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab193293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 27 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance

    Part of the 30S ribosomal subunit. Some nascent polypeptide chains are able to cross-link to this protein in situ. Belongs to the ribosomal protein S2P family.
  • Database links

    • Alternative names

      • 30S ribosomal protein S2 antibody
      • b0169 antibody
      • JW0164 antibody
      • rpsB antibody

    Images

    • All lanes : Anti-rpsB antibody (ab193293) at 2.5 µg/ml

      Lane 1 : Rosseta bacteria lysate at 80 µg
      Lane 2 : Rosseta bacteria lysate at 40 µg
      Lane 3 : Rosseta bacteria lysate at 20 µg
      Lane 4 : Rosseta bacteria lysate at 10 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 27 kDa
      Observed band size: 27 kDa

    References

    ab193293 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193293.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up