For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    rpt5tbp-1-antibody-ab22676.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Ubiquitin
Share by email

Anti-Rpt5/TBP-1 antibody (ab22676)

  • Datasheet
Submit a review Submit a question References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Rpt5/TBP-1 antibody (ab22676)

    Key features and details

    • Rabbit polyclonal to Rpt5/TBP-1
    • Suitable for: WB
    • Reacts with: Saccharomyces cerevisiae, Arabidopsis thaliana, Fungi
    • Isotype: IgG

    You may also be interested in

    Primary
    Product image
    Anti-APG5L/ATG5 antibody [EPR1755(2)] (ab108327)
    Protein
    Product image
    Recombinant human PDE5A/PDE5 protein (ab125581)
    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-Rpt5/TBP-1 antibody
    • Description

      Rabbit polyclonal to Rpt5/TBP-1
    • Host species

      Rabbit
    • Specificity

      ab22676 reacts with 19S regulator ATPase subunit Rpt5/TBP-1 (Yta1).

    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Saccharomyces cerevisiae, Arabidopsis thaliana, Fungi
    • Immunogen

      Recombinant fragment corresponding to Saccharomyces cerevisiae Rpt5/TBP-1 aa 1-100 (N terminal).
      Sequence:

      MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQR LSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSEST

      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • Yeast 26S proteasome
    • General notes

      The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

      If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
    • Storage buffer

      Constituent: Whole serum
    • Concentration information loading...
    • Purity

      Whole antiserum
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cell Biology
      • Proteolysis / Ubiquitin
      • Proteasome / Ubiquitin
      • Ubiquitin
      • Signal Transduction
      • Metabolism
      • Plasma Membrane
      • ATPases
      • Metabolism
      • Types of disease
      • Cancer

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab22676 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB
    Notes
    Application notes
    WB: 1/10000 - 1/50000. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa).
    Notes: Dilute to working strength with phosphate buffered saline pH 7.2-7.4 and 1% normal goat serum (if a goat anti-rabbit IgG linker antibody is to be used).

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    Target

    • Relevance

      In the yeast S. cerevisiae 12 different members of a novel gene family of putative ATPases have been identified and characterised. Due to their similarities to TBP1, a human immunodeficiency tat binding protein, they have been designated the YTA family or yeast tat binding analogues. All share a region of high similarity of approximately 300 amino acids in length. Rpt5p or YTA1 ,is one of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates.
    • Cellular localization

      Nuclear
    • Database links

      • Entrez Gene: 854284 Saccharomyces cerevisiae
      • SwissProt: P33297 Saccharomyces cerevisiae
      • Alternative names

        • 26S protease regulatory subunit 6A antibody
        • TAT binding protein homolog 1 antibody
        • TBP1 antibody
        • YTA1 antibody

      Images

      • Western blot - Anti-Rpt5/TBP-1 antibody (ab22676)
        Western blot - Anti-Rpt5/TBP-1 antibody (ab22676)
        Anti-Rpt5/TBP-1 antibody (ab22676) at 1/25000 dilution (PVDF blotting membrane)
        Developed using the ECL technique.

        Performed under reducing conditions.

        Predicted band size: 48 kDa
        Observed band size: 48 kDa


        Exposure time: 1 minute

      Protocols

      • Western blot protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet download

        Download

      References (3)

      Publishing research using ab22676? Please let us know so that we can cite the reference in this datasheet.

      ab22676 has been referenced in 3 publications.

      • García-León M  et al. Arabidopsis ALIX Regulates Stomatal Aperture and Turnover of Abscisic Acid Receptors. Plant Cell 31:2411-2429 (2019). PubMed: 31363038
      • Song Z  et al. Constitutive Expression of miR408 Improves Biomass and Seed Yield in Arabidopsis. Front Plant Sci 8:2114 (2017). PubMed: 29422907
      • Wang Y  et al. Repression of MYBL2 by Both microRNA858a and HY5 Leads to the Activation of Anthocyanin Biosynthetic Pathway in Arabidopsis. Mol Plant 9:1395-1405 (2016). PubMed: 27450422

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab22676.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2022 Abcam plc. All rights reserved.