Overview

  • Product name

  • Description

    Rabbit polyclonal to RRAGC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human RRAGC aa 1-250.
    Sequence:

    MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG GCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIY KDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDY MEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRAN DDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLNIF


    Database link: Q9HB90

  • Positive control

    • WB: HeLa, MCF7 and A549 whole cell lysates. IHC-P: Human adrenal gland and small intestine tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab230184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 44 kDa (predicted molecular weight: 44 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.
  • Sequence similarities

    Belongs to the GTR/RAG GTP-binding protein family.
  • Cellular localization

    Cytoplasm. Nucleus. Lysosome. Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state of associated RRAGA.
  • Information by UniProt
  • Database links

  • Alternative names

    • AU041672 antibody
    • FLJ13311 antibody
    • GTPase interacting protein 2 antibody
    • GTPase-interacting protein 2 antibody
    • GTR2 antibody
    • MGC47404 antibody
    • OTTHUMP00000000548 antibody
    • Rag C antibody
    • Rag C protein antibody
    • RAGC antibody
    • Ras related GTP binding C antibody
    • Ras-related GTP-binding protein C antibody
    • RP23 29H22.4 antibody
    • RRAGC antibody
    • RRAGC_HUMAN antibody
    • TIB929 antibody
    • YGR163W antibody
    see all

Images

  • All lanes : Anti-RRAGC antibody (ab230184) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat anti-Rabbit IgG at 1/10000 dilution

    Predicted band size: 44 kDa
    Observed band size: 44 kDa

  • Paraffin-embedded human adrenal gland tissue stained for RRAGC with ab230184 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for RRAGC with ab230184 at 1/100 dilution in immunohistochemical analysis.

References

ab230184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up