Anti-RRAGC antibody - BSA and Azide free (ab206864)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RRAGC antibody - BSA and Azide free
See all RRAGC primary antibodies -
Description
Rabbit polyclonal to RRAGC - BSA and Azide free -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Hamster, Human -
Immunogen
Full length native protein (purified) (GST-tag) corresponding to Human RRAGC aa 1-399.
Sequence:MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG GCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIY KDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDY MEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRAN DDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIF ISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYG LKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKG LIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI
Database link: Q9HB90 -
Positive control
- HeLa, MCF7, MOLT4, NIH 3T3 and CHO cell lysates; HeLa cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Constituents: 50% PBS, 50% Glycerol
ab206864 is filter-sterilized -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
ab206864 is a purified IgG fraction. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab206864 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/2000. Predicted molecular weight: 44 kDa. | |
| ICC/IF | 1/100 - 1/500. |
Target
-
Function
Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. -
Sequence similarities
Belongs to the GTR/RAG GTP-binding protein family. -
Cellular localization
Cytoplasm. Nucleus. Lysosome. Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state of associated RRAGA. - Information by UniProt
-
Database links
- Entrez Gene: 64121 Human
- Entrez Gene: 54170 Mouse
- Omim: 608267 Human
- SwissProt: Q9HB90 Human
- SwissProt: Q99K70 Mouse
- Unigene: 532461 Human
- Unigene: 220922 Mouse
- Unigene: 473825 Mouse
-
Alternative names
- AU041672 antibody
- FLJ13311 antibody
- GTPase interacting protein 2 antibody
see all
Images
-
Western blot - Anti-RRAGC antibody - BSA and Azide free (ab206864)All lanes : Anti-RRAGC antibody - BSA and Azide free (ab206864) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : MCF7 cell lysate
Lane 3 : MOLT4 cell lysate
Lane 4 : NIH 3T3 cell lysate
Lane 5 : CHO cell lysate
Lysates/proteins at 20 µg per lane.
Secondary
All lanes : anti-rabbit IgG conjugated with HRP at 1/10000 dilution
Predicted band size: 44 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-RRAGC antibody - BSA and Azide free (ab206864)Immunofluorecent analysis of HeLa cells (fixed with 4% paraformaldehyde and permeabilized with 0.5% TritonX 100) labeling RRAGC with ab206864 at a 1/100 dilution. Secondary staining with anti-rabbit IgG antibody conjugated with Alexa Fluor 647 (red), was used at 1/1000 dilution. DNA was stained with DAPI (blue).
Datasheets and documents
References
ab206864 has not yet been referenced specifically in any publications.
