Anti-RRAGC antibody - BSA and Azide free (ab206864)
Key features and details
- Rabbit polyclonal to RRAGC - BSA and Azide free
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Hamster, Human
- Isotype: IgG
Overview
-
Product name
Anti-RRAGC antibody - BSA and Azide free
See all RRAGC primary antibodies -
Description
Rabbit polyclonal to RRAGC - BSA and Azide free -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Hamster, Human -
Immunogen
Full length native protein (purified) (GST-tag) corresponding to Human RRAGC aa 1-399.
Sequence:MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG GCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIY KDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDY MEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRAN DDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIF ISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYG LKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKG LIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI
Database link: Q9HB90 -
Positive control
- HeLa, MCF7, MOLT4, NIH 3T3 and CHO cell lysates; HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 6
Constituents: 50% PBS, 50% Glycerol (glycerin, glycerine)
ab206864 is filter-sterilized -
Carrier free
Yes -
Concentration information loading... -
Purity
Protein A purified -
Purification notes
ab206864 is a purified IgG fraction. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab206864 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/1000 - 1/2000. Predicted molecular weight: 44 kDa. | |
| ICC/IF | 1/100 - 1/500. |
Target
-
Function
Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. -
Sequence similarities
Belongs to the GTR/RAG GTP-binding protein family. -
Cellular localization
Cytoplasm. Nucleus. Lysosome. Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state of associated RRAGA. - Information by UniProt
-
Database links
- Entrez Gene: 64121 Human
- Entrez Gene: 54170 Mouse
- Omim: 608267 Human
- SwissProt: Q9HB90 Human
- SwissProt: Q99K70 Mouse
- Unigene: 532461 Human
- Unigene: 220922 Mouse
- Unigene: 473825 Mouse
-
Alternative names
- AU041672 antibody
- FLJ13311 antibody
- GTPase interacting protein 2 antibody
see all
Images
-
Western blot - Anti-RRAGC antibody - BSA and Azide free (ab206864)All lanes : Anti-RRAGC antibody - BSA and Azide free (ab206864) at 1/1000 dilution
Lane 1 : HeLa cell lysate
Lane 2 : MCF7 cell lysate
Lane 3 : MOLT4 cell lysate
Lane 4 : NIH 3T3 cell lysate
Lane 5 : CHO cell lysate
Lysates/proteins at 20 µg per lane.
Secondary
All lanes : anti-rabbit IgG conjugated with HRP at 1/10000 dilution
Predicted band size: 44 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-RRAGC antibody - BSA and Azide free (ab206864)Immunofluorecent analysis of HeLa cells (fixed with 4% paraformaldehyde and permeabilized with 0.5% TritonX 100) labeling RRAGC with ab206864 at a 1/100 dilution. Secondary staining with anti-rabbit IgG antibody conjugated with Alexa Fluor 647 (red), was used at 1/1000 dilution. DNA was stained with DAPI (blue).
Protocols
Datasheets and documents
References (0)
ab206864 has not yet been referenced specifically in any publications.
