Overview

  • Product name

    Anti-RRAGC antibody - BSA and Azide free
    See all RRAGC primary antibodies
  • Description

    Rabbit polyclonal to RRAGC - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Hamster, Human
  • Immunogen

    Full length native protein (purified) (GST-tag) corresponding to Human RRAGC aa 1-399.
    Sequence:

    MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG GCGPGGADSSKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIY KDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALIYVIDAQDDY MEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRAN DDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIF ISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYG LKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKG LIDYNFHCFRKAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI


    Database link: Q9HB90

  • Positive control

    • HeLa, MCF7, MOLT4, NIH 3T3 and CHO cell lysates; HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab206864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 44 kDa.
ICC/IF 1/100 - 1/500.

Target

  • Function

    Has guanine nucleotide-binding activity but weak intrinsic GTPase activity. Probably required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids.
  • Sequence similarities

    Belongs to the GTR/RAG GTP-binding protein family.
  • Cellular localization

    Cytoplasm. Nucleus. Lysosome. Predominantly cytoplasmic. May shuttle between the cytoplasm and nucleus, depending on the bound nucleotide state of associated RRAGA.
  • Information by UniProt
  • Database links

  • Alternative names

    • AU041672 antibody
    • FLJ13311 antibody
    • GTPase interacting protein 2 antibody
    • GTPase-interacting protein 2 antibody
    • GTR2 antibody
    • MGC47404 antibody
    • OTTHUMP00000000548 antibody
    • Rag C antibody
    • Rag C protein antibody
    • RAGC antibody
    • Ras related GTP binding C antibody
    • Ras-related GTP-binding protein C antibody
    • RP23 29H22.4 antibody
    • RRAGC antibody
    • RRAGC_HUMAN antibody
    • TIB929 antibody
    • YGR163W antibody
    see all

Images

  • All lanes : Anti-RRAGC antibody - BSA and Azide free (ab206864) at 1/1000 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : MCF7 cell lysate
    Lane 3 : MOLT4 cell lysate
    Lane 4 : NIH 3T3 cell lysate
    Lane 5 : CHO cell lysate

    Lysates/proteins at 20 µg per lane.

    Secondary
    All lanes : anti-rabbit IgG conjugated with HRP at 1/10000 dilution

    Predicted band size: 44 kDa

  • Immunofluorecent analysis of HeLa cells (fixed with 4% paraformaldehyde and permeabilized with 0.5% TritonX 100) labeling RRAGC with ab206864 at a 1/100 dilution. Secondary staining with anti-rabbit IgG antibody conjugated with Alexa Fluor 647 (red), was used at 1/1000 dilution. DNA was stained with DAPI (blue).

References

ab206864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up