Overview

  • Product name

  • Description

    Rabbit polyclonal to RRP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to Human RRP2 aa 51-100 (N terminal).
    Sequence:

    KWMLPEKSRGTYLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWIT


    Database link: NP_060291

  • Positive control

    • PANC1 cell lysate
  • General notes

    Previously labelled as RHBDL2

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab105014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance

    RRP2, rhomboid like protein 2, is involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. There are 2 named isoforms produced by alternative splicing.
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • MGC16997 antibody
    • RHBDL2 antibody
    • Rhomboid like protein 2 antibody
    • Rhomboid related protein 2 antibody
    • Rhomboid veinlet like 2 (Drosophila) antibody
    • RRP2 antibody
    see all

Images

  • Anti-RRP2 antibody (ab105014) at 1 µg/ml + PANC1 cell lysate at 10 µg

    Predicted band size: 34 kDa



    12% gel

References

ab105014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

According to our records, ab105014 was proving difficult to use in IHC and we were in contact in order to help resolve the issue. Looking at our correspondence, it appears that we are awaiting more details in order to help us better understand the difficulties experienced. If the requested information has already been sent, it appears that it did not reach our Scientific Support team and we apologize for this inconvenience. In this case we would like to ask for the information again so that we can reach a resolution. If the issue has already been settled, please let us know so that we can be assured that the problem has been solved to your satisfaction and update our records. We wish you the best of luck with your research and look forward to a reply.  

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up