Overview

  • Product name

  • Description

    Rabbit polyclonal to RRP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human RRP2 aa 12-132.
    Sequence:

    MNLNMGREMKEELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGT YLERANCFPPPVFIISISLAELAVFIYYAVWKPQKQWITLDTGILESPFI YSPEKREEAWRFISYMLVHAG


    Database link: Q9NX52

  • Positive control

    • WB: HeLa, HEK-293T, A431 and A549 whole cell lysates; Mouse brain lysate. IHC-P: Human colon cancer tissue. ICC/IF: HEK-293T cells.
  • General notes

    Previously labelled as RHBDL2

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 34 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    RRP2, rhomboid like protein 2, is involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. There are 2 named isoforms produced by alternative splicing.
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • MGC16997 antibody
    • RHBDL2 antibody
    • Rhomboid like protein 2 antibody
    • Rhomboid related protein 2 antibody
    • Rhomboid veinlet like 2 (Drosophila) antibody
    • RRP2 antibody
    see all

Images

  • All lanes : Anti-RRP2 antibody (ab236793) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 3 : A431 (human epidermoid carcinoma cell line) whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 5 : Mouse brain lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 34 kDa

  • HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells stained for RRP2 (green) using ab236793 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for RRP2 using ab236793 at 1/100 dilution in immunohistochemical analysis.

References

ab236793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up