Overview

  • Product name

    Anti-RRP2 antibody - N-terminal
    See all RRP2 primary antibodies
  • Description

    Rabbit polyclonal to RRP2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human RRP2 aa 23-72 (N terminal). The exact sequence is proprietary.
    Sequence:

    ELEEEEKMREDGGGKDRAKSKKVHRIVSKWMLPEKSRGTYLERANCFPPP


    Database link: Q9NX52

  • Positive control

    • 293T whole cell lysate.
  • General notes

    Previously labelled as RHBDL2

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Relevance

    RRP2, rhomboid like protein 2, is involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. There are 2 named isoforms produced by alternative splicing.
  • Cellular localization

    Membrane; Multi pass membrane protein.
  • Database links

  • Alternative names

    • MGC16997 antibody
    • RHBDL2 antibody
    • Rhomboid like protein 2 antibody
    • Rhomboid related protein 2 antibody
    • Rhomboid veinlet like 2 (Drosophila) antibody
    • RRP2 antibody
    see all

Images

  • Anti-RRP2 antibody - N-terminal (ab179726) at 1 µg/ml + 293T whole cell lysate at 10 µg

    Predicted band size: 34 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up