Overview

  • Product name

    Anti-RRP41 antibody
  • Description

    Rabbit polyclonal to RRP41
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Rhesus monkey, Gorilla, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human RRP41 aa 1-50. The exact sequence is proprietary.
    Sequence:

    MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALA


    Database link: NP_061910.1

  • Positive control

    • HeLa, 293T and Jurkat whole cell lysate (ab7899)
  • General notes

    Protein previously labeled as EXOSC4.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7 to 8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab137250 was affinity purified using an epitope specific to RRP41 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab137250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 26 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

  • Function

    Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC4 binds to ARE-containing RNAs.
  • Sequence similarities

    Belongs to the RNase PH family.
  • Cellular localization

    Cytoplasm. Nucleus, nucleolus. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • EXOS4_HUMAN antibody
    • EXOSC 4 antibody
    • EXOSC4 antibody
    • Exosome complex component RRP41 antibody
    • Exosome complex exonuclease RRP41 antibody
    • Exosome component 4 antibody
    • Exosome component Rrp41 antibody
    • FLJ20591 antibody
    • hRrp41p antibody
    • p12A antibody
    • Ribosomal RNA processing protein 41 antibody
    • Ribosomal RNA-processing protein 41 antibody
    • RRP 41 antibody
    • RRP41 antibody
    • RRP41A antibody
    • Rrp41p antibody
    • SKI 6 antibody
    • SKI6 antibody
    • Ski6p antibody
    see all

Images

  • All lanes : Anti-RRP41 antibody (ab137250) at 0.4 µg/ml

    Lane 1 : HeLa whole cell lysate at 50 µg
    Lane 2 : HeLa whole cell lysate at 15 µg
    Lane 3 : 293T whole cell lysate at 50 µg
    Lane 4 : Jurkat whole cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 26 kDa


    Exposure time: 3 minutes
  • Immunoprecipitation with ab137250 at 6µg/mg lysate. 1 mg of HeLa whole cell lysate used for IP (20% of IP loaded). Western blot labelling RRP41 with ab137250 at 1 µg/ml. Detected by chemiluminescence with exposure time of 30 seconds.

References

This product has been referenced in:

  • Aly HH  et al. RNA Exosome Complex Regulates Stability of the Hepatitis B Virus X-mRNA Transcript in a Non-stop-mediated (NSD) RNA Quality Control Mechanism. J Biol Chem 291:15958-74 (2016). WB ; Human . Read more (PubMed: 27281821) »
  • Macias S  et al. DGCR8 Acts as an Adaptor for the Exosome Complex to Degrade Double-Stranded Structured RNAs. Mol Cell 60:873-85 (2015). Read more (PubMed: 26687677) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up