Overview

  • Product name

    Anti-RRS1 antibody
  • Description

    Rabbit polyclonal to RRS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human RRS1 aa 207-280.
    Sequence:

    LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQP LFGDFAAEKKNQLELLRVMNSKKP


    Database link: Q15050

  • Positive control

    • IHC-P: fallopian tube, pancreas, cerebral cortex and rectum tissue WB: PC-3 and HeLa cell lysate ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab188161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/1000 - 1/2500. Predicted molecular weight: 41 kDa.

Target

Images

  • Immunohistochemical analysis of human rectum tissue labeling RRS1 with ab188161 at 1/1000 dilution.
  • Immunohistochemical analysis of human cerebral cortex tissue labeling RRS1 with ab188161 at 1/1000 dilution.
  • Immunohistochemical analysis of human pancreas tissue labeling RRS1 with ab188161 at 1/1000 dilution.
  • Immunohistochemical analysis of human fallopian tube tissue labeling RRS1 with ab188161 at 1/1000 dilution.
  • All lanes : Anti-RRS1 antibody (ab188161) at 0.4 µg/ml

    Lane 1 : PC-3 cell lysate
    Lane 2 : HeLa cell lysate

    Predicted band size: 41 kDa

  • Immunofluorescence analysis of Human cell line U-2 OS labeling RRS1 with ab188161 at 4 µg/ml.

References

This product has been referenced in:

  • Wu XL  et al. RRS1 silencing suppresses colorectal cancer cell proliferation and tumorigenesis by inhibiting G2/M progression and angiogenesis. Oncotarget 8:82968-82980 (2017). Read more (PubMed: 29137316) »
  • Wang J  et al. Knockdown of RRS1 by lentiviral-mediated RNAi promotes apoptosis and suppresses proliferation of human hepatocellular carcinoma cells. Oncol Rep 38:2166-2172 (2017). Read more (PubMed: 28849112) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up