Overview

  • Product name

  • Description

    Rabbit polyclonal to RS1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human RS1 aa 24-224. Mature chain. Two N-terminal tags, His-tag and GST-tag. Expressed in E.coli.
    Sequence:

    STEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFES GEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWL QIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNN RVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKC A


    Database link: O15537

  • Positive control

    • WB: Recombinant human RS1 protein; Pig eye tissue lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 26 kDa.

Target

  • Function

    May be active in cell adhesion processes during retinal development.
  • Tissue specificity

    Restricted to the retina (at protein level). At the mRNA level, detected only within the photoreceptor cell layer, most prominently within the inner segments of the photoreceptors. Undetectable in the inner plexiform layers and the inner nuclear layer. At the protein level, found in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer. At the macula, expressed in both the outer and inner nuclear layers and in the inner plexiform layer (at protein level).
  • Involvement in disease

    Defects in RS1 are the cause of retinoschisis juvenile X-linked type 1 (XLRS1) [MIM:312700]. A vitreo-retinal dystrophy characterized by macular pathology and by splitting of the superficial layer of the retina. Macular changes are present in almost all cases. In the fundi, radially oriented intraretinal foveomacular cysts are seen in a spoke-wheel configuration, with the absence of foveal reflex in most cases. In addition, approximately half of cases have bilateral peripheral retinoschisis in the inferotemporal part of the retina. Aside from the typical fundus appearance, strabismus, nystagmus, axial hyperopia, defective color vision and foveal ectopy can be present. The most important complications are vitreous hemorrhage, retinal detachment, and neovascular glaucoma.
  • Sequence similarities

    Contains 1 F5/8 type C domain.
  • Developmental stage

    Up-regulated during the differentiation of a retinoblastoma cell line.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Retinoschisin antibody
    • RS1 antibody
    • X-linked juvenile retinoschisis protein antibody
    • XLRS1_HUMAN antibody

Images

  • Anti-RS1 antibody (ab233428) at 2 µg/ml + Pig eye tissue lysate.

    Predicted band size: 26 kDa

  • Anti-RS1 antibody (ab233428) at 2 µg/ml + Recombinant human RS1 protein.

    Predicted band size: 26 kDa

References

ab233428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up