Overview

  • Product name
    Anti-RSG1 antibody - N-terminal
    See all RSG1 primary antibodies
  • Description
    Rabbit polyclonal to RSG1 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human, Pig
  • Immunogen

    Synthetic peptide within Mouse RSG1 aa 32-81 (N terminal). The exact sequence is proprietary. Immunogen located within 50 amino acid sequence.
    Sequence:

    NRRREFGLLERPVLPPSVVIDTASYKIFVSGKSGVGKTALVAKLAGLEVP


    Database link: NP_001074643

  • Positive control
    • Mouse spleen lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab175138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 28 kDa (predicted molecular weight: 28 kDa).

Target

  • Function
    Potential effector of the planar cell polarity signaling pathway. Plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. Involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia. More generally involved in exocytosis in secretory cells.
  • Sequence similarities
    Belongs to the small GTPase superfamily. Rab family.
  • Cellular localization
    Cytoplasm > cytoskeleton > cilium basal body.
  • Information by UniProt
  • Database links
  • Alternative names
    • C1orf89 antibody
    • Miro domain containing protein C1orf89 antibody
    • Rem/Rab Similar GTPase 1 antibody
    • REM2- and Rab-like small GTPase 1 antibody
    • RP4-733M16.4 antibody
    • Rsg1 antibody
    • RSG1_HUMAN antibody
    see all

Images

  • Anti-RSG1 antibody - N-terminal (ab175138) at 1 µg/ml + Mouse spleen lysate at 10 µg

    Predicted band size: 28 kDa

References

ab175138 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up