Overview

  • Product name

  • Description

    Rabbit polyclonal to RSPO1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat RSPO1 aa 136-262. (Expressed in E.coli).
    Sequence:

    ANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFRKGSEERTRRVLHAPGG DQTNCSDTKETRKCTVRRTPCPEGQKRKKASQGRRENANRHPTRKNSKEP GSNSRRHKGQQQPQPGTAGPLTSVGPT


    Database link: D3ZBD1

  • Positive control

    • IHC-P: Rat testis, kidney, stomach and pancreas tissues. WB: Rat uterus lysate; Recombinant rat RSPO1 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231125 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 29 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination.
  • Tissue specificity

    Abundantly expressed in adrenal glands, ovary, testis, thyroid and trachea but not in bone marrow, spinal cord, stomach, leukocytes colon, small intestine, prostate, thymus and spleen.
  • Involvement in disease

    Defects in RSPO1 are the cause of palmoplantar keratoderma with squamous cell carcinoma of skin and sex reversal (PKKSCC) [MIM:610644]. This recessive syndrome is characterized by XX (female to male) SRY-independent sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin.
  • Sequence similarities

    Belongs to the R-spondin family.
    Contains 2 FU (furin-like) repeats.
    Contains 1 TSP type-1 domain.
  • Domain

    The FU repeats are required for activation and stabilization of beta-catenin.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • CRISTIN3 antibody
    • FLJ40906 antibody
    • hRspo1 antibody
    • R spondin homolog (Xenopus laevis) antibody
    • R spondin homolog antibody
    • R spondin1 antibody
    • R-spondin-1 antibody
    • Roof plate specific spondin antibody
    • Roof plate-specific spondin-1 antibody
    • RP11-566C13.1 antibody
    • RSPO antibody
    • Rspo1 antibody
    • RSPO1_HUMAN antibody
    see all

Images

  • Paraffin-embedded rat testis tissue stained for RSPO1 using ab231125 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat kidney tissue stained for RSPO1 using ab231125 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for RSPO1 using ab231125 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat pancreas tissue stained for RSPO1 using ab231125 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-RSPO1 antibody (ab231125) at 5 µg/ml + Recombinant rat RSPO1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 29 kDa

  • Anti-RSPO1 antibody (ab231125) at 5 µg/ml + Rat uterus lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 29 kDa

References

ab231125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up