Anti-RSPO3 antibody (ab233113)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-RSPO3 antibody
See all RSPO3 primary antibodies -
Description
Rabbit polyclonal to RSPO3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow
-
Immunogen
Recombinant full length protein (His-T7-tag) corresponding to Human RSPO3 aa 22-272. (Expressed in E.coli).
Sequence:QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMK QIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLH LGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRG TETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRK KPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTV H
Database link: Q9BXY4 -
Positive control
- IHC-P: Human breast cancer, pancreatic cancer, glioma, liver and bile duct cancer tissues. WB: Pig small intestine lysate; Recombinant human RSPO3 protein.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab233113 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233113 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa. | |
| IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. -
Tissue specificity
Ubiquitously expressed. Expressed at higher level in placenta, small intestine, fetal thymus and lymph node. -
Sequence similarities
Belongs to the R-spondin family.
Contains 2 FU (furin-like) repeats.
Contains 1 TSP type-1 domain. -
Domain
The FU repeats are required for activation and stabilization of beta-catenin. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 534650 Cow
- Entrez Gene: 84870 Human
- Omim: 610574 Human
- SwissProt: Q1RMU1 Cow
- SwissProt: Q9BXY4 Human
- Unigene: 135254 Human
-
Alternative names
- CRISTIN1 antibody
- hPWTSR antibody
- hRspo3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)Paraffin-embedded human breast cancer tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)Paraffin-embedded human pancreatic cancer tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)Paraffin-embedded human glioma tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)Paraffin-embedded human liver tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)Paraffin-embedded human bile duct cancer tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-RSPO3 antibody (ab233113)Anti-RSPO3 antibody (ab233113) at 2 µg/ml + Recombinant human RSPO3 protein
Predicted band size: 31 kDa -
Western blot - Anti-RSPO3 antibody (ab233113)Anti-RSPO3 antibody (ab233113) at 2 µg/ml + Pig small intestine lysate
Predicted band size: 31 kDa
Datasheets and documents
References
ab233113 has not yet been referenced specifically in any publications.
