Anti-RSPO3 antibody (ab233113)
Key features and details
- Rabbit polyclonal to RSPO3
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RSPO3 antibody
See all RSPO3 primary antibodies -
Description
Rabbit polyclonal to RSPO3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow -
Immunogen
Recombinant full length protein (His-T7-tag) corresponding to Human RSPO3 aa 22-272. (Expressed in E.coli).
Sequence:QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMK QIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLH LGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRG TETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRK KPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTV H
Database link: Q9BXY4 -
Positive control
- IHC-P: Human breast cancer, pancreatic cancer, glioma, liver and bile duct cancer tissues. WB: Pig small intestine lysate; Recombinant human RSPO3 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab233113 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233113 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 31 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Activator of the beta-catenin signaling cascade, leading to TCF-dependent gene activation. Acts both in the canonical Wnt/beta-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent beta catenin pathway through a receptor signaling pathway that may not use frizzled/LRP receptors. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. -
Tissue specificity
Ubiquitously expressed. Expressed at higher level in placenta, small intestine, fetal thymus and lymph node. -
Sequence similarities
Belongs to the R-spondin family.
Contains 2 FU (furin-like) repeats.
Contains 1 TSP type-1 domain. -
Domain
The FU repeats are required for activation and stabilization of beta-catenin. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 534650 Cow
- Entrez Gene: 84870 Human
- Omim: 610574 Human
- SwissProt: Q1RMU1 Cow
- SwissProt: Q9BXY4 Human
- Unigene: 135254 Human
-
Alternative names
- CRISTIN1 antibody
- hPWTSR antibody
- hRspo3 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)
Paraffin-embedded human breast cancer tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)
Paraffin-embedded human pancreatic cancer tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)
Paraffin-embedded human glioma tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)
Paraffin-embedded human liver tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RSPO3 antibody (ab233113)
Paraffin-embedded human bile duct cancer tissue stained for RSPO3 using ab233113 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-RSPO3 antibody (ab233113) at 2 µg/ml + Recombinant human RSPO3 protein
Predicted band size: 31 kDa -
Anti-RSPO3 antibody (ab233113) at 2 µg/ml + Pig small intestine lysate
Predicted band size: 31 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233113 has not yet been referenced specifically in any publications.