Overview

  • Product name

  • Description

    Rabbit polyclonal to RST
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RST aa 281-352.
    Sequence:

    ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSM GQPPASLGTLLRMPGLRFRTCI


    Database link: Q96S37

  • Positive control

    • WB: RT-4 and Human plasma IHC-P: Human kidney tissue

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab121826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions.
  • Tissue specificity

    Detected in kidney (at protein level). Detected in fetal and adult kidney. Detected in epithelial cells of proximal tubules in renal cortex.
  • Involvement in disease

    Defects in SLC22A12 are a cause of renal hypouricemia (RH) [MIM:220150]. Patients have low serum urate levels, due to defects in renal urate re-absorption and high urinary urate excretion. Patients often appear asymptomatic, but may be subject to exercise-induced acute renal failure (ARF), chronic renal dysfunction and uric acid urolithiasis.
  • Sequence similarities

    Belongs to the major facilitator superfamily. Organic cation transporter family.
  • Cellular localization

    Cell membrane. Detected in the luminal membrane of the epithelium of renal proximal tubules.
  • Information by UniProt
  • Database links

  • Alternative names

    • Organic anion transporter 4-like protein antibody
    • Renal-specific transporter antibody
    • RST antibody
    • S22AC_HUMAN antibody
    • Slc22a12 antibody
    • Solute carrier family 22 member 12 antibody
    • Urate anion exchanger 1 antibody
    see all

Images

  • ab121826, at a 1/250 dilution, staining RST in paraffin embedded Human kidney tissue by Immunohistochemistry.

References

ab121826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab121826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up