Overview

  • Product name

  • Description

    Rabbit polyclonal to RSUME
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human RSUME aa 92-141 (internal sequence).
    Sequence:

    ESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLWI


    Database link: NP_056300

  • Positive control

    • 293T cell lysate.
  • General notes

    Previously labelled as RWDD3. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab128285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Enhances the sumoylation of a number of proteins including HIF1A, PIAS and I-kappa-B, through direct interaction with UBC9. Has no effect on ubiquitination.
  • Tissue specificity

    Expressed in a wide number of tissues with highest expression in cerebellum, pituitary, heart, kidney, liver, stomach, pancreas, prostate and spleen. Low levels in thalamus, spinal cord, esophagus, thymus, lung and peripheral blood leukocytes.
  • Sequence similarities

    Contains 1 RWD domain.
  • Domain

    The RWD domain is required for the sumoylation enhancement activity.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with UBC9/UBE2I in nuclear spots.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp566K023 antibody
    • RSUME antibody
    • RWD containing sumoylation enhancer antibody
    • RWD domain containing 3 antibody
    • RWD domain containing protein antibody
    • RWD domain containing protein 3 antibody
    • RWD domain-containing protein 3 antibody
    • RWD-containing sumoylation enhancer antibody
    • rwdd3 antibody
    • RWDD3_HUMAN antibody
    see all

Images

  • Anti-RSUME antibody (ab128285) at 1 µg/ml + 293T cell lysate at 10 µg

    Developed using the ECL technique.

    Predicted band size: 31 kDa



    Gel concentration: 12%.

References

ab128285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab128285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up