Overview

  • Product name

  • Description

    Rabbit polyclonal to RTF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Drosophila melanogaster
  • Immunogen

    Recombinant full length protein corresponding to Drosophila melanogaster RTF1 aa 1-775.
    Sequence:

    MGKRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRKKPQTAAKSSSRSD SDSDWANNKAGAPSSKKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPA QTQQEHKPPEQASQPAQLSEQEEGEVSDSDSDKSKSNSSSSGSDSSSSSS SSDSEFDDGFDDDLMGDDEDRRRLNGLSEKERETEIYKRIEQREIMRTRW EIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKAREAQAPLPTQ ASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASS AGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEE AKRMAEKDRDDDKEELDSVSGCKSAVKLKASEIYSDDSGSSDWDEEEKPA GKRSRSNSSKASSESEDEEKAPQRPVFITTREDLNKLRLSRYKMERFVNL PIFESTVLNCFVRISIGNNGQKPVYRVAEIVGVVETGKIYSLGTTRTNRG LRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQMPTIDLIAIK QNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAML RGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDA EKAILEEARANKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLAPLPPPP PGKKRPNEAGTSSASVRSTDSKDYSLYSLHDFDIDLDVPLPVNTNSVPKP ASKPAETVSKRSLNLEDYKKKRGLI


    Database link: Q9W261

  • Positive control

    • WB: Whole cell extracts from drosophila larva.

Properties

Applications

Our Abpromise guarantee covers the use of ab231291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 88 kDa.

Target

  • Function

    Plays a role in transcription-coupled histone modification. Plays a role in regulation of transcription. Required for maximal induction of heat-shock genes (By similarity). Binds single-stranded DNA.
  • Sequence similarities

    Contains 1 Plus3 domain.
  • Domain

    The Plus3 domain mediates single-stranded DNA-binding.
  • Cellular localization

    Nucleus > nucleoplasm.
  • Information by UniProt
  • Database links

    • Alternative names

      • CDG1N antibody
      • GTL 7 antibody
      • GTL7 antibody
      • KIAA0252 antibody
      • Ortholog of mouse gene trap locus 7 antibody
      • RNA polymerase associated protein RTF1 homolog antibody
      • RNA polymerase-associated protein RTF1 homolog antibody
      • RTF 1 antibody
      • RTF1 antibody
      • Rtf1 Paf1/RNA polymerase II complex component homolog antibody
      • RTF1_HUMAN antibody
      • rtf1L antibody
      • YGL244W antibody
      see all

    Images

    • All lanes : Anti-RTF1 antibody (ab231291) at 1/1000 dilution

      Lane 1 : Whole cell extracts from drosophila larva
      Lane 2 : Whole cell extracts from drosophila adults

      Predicted band size: 88 kDa

    References

    ab231291 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab231291.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up