Anti-RTN3/HAP antibody (ab246911)

Submit a review Submit a question

Overview

  • Product name

    Anti-RTN3/HAP antibody
    See all RTN3/HAP primary antibodies

  • Description

    Rabbit polyclonal to RTN3/HAP

  • Host species

    Rabbit

  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human RTN3/HAP aa 81-217.
    Sequence:

    IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKM EKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQI DKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY


    Database link: O95197

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human cerebral cortex tissue. ICC/IF: U-2 OS cells.

  • General notes

     This product was previously labelled as RTN3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab246911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis.

  • Tissue specificity

    Isoform 3 is widely expressed, with highest levels in brain, where it is enriched in neuronal cell bodies from gray matter (at protein level). Three times more abundant in macula than in peripheral retina. Isoform 1 is expressed at high levels in brain and at low levels in skeletal muscle. Isoform 2 is only found in melanoma.

  • Sequence similarities

    Contains 1 reticulon domain.

  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • ASYIP antibody
      • Neuroendocrine specific protein like 2 antibody
      • Neuroendocrine-specific protein-like 2 antibody
      • Neuroendocrine-specific protein-like II antibody
      • NSP like protein II antibody
      • NSP-like protein 2 antibody
      • NSP-like protein II antibody
      • NSPL2 antibody
      • NSPLII antibody
      • Reticulon 3 antibody
      • Reticulon-3 antibody
      • Reticulon3 antibody
      • Rtn3 antibody
      • RTN3_HUMAN antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-RTN3/HAP antibody (ab246911)
      Immunocytochemistry/ Immunofluorescence - Anti-RTN3/HAP antibody (ab246911)

      PFA-fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells stained for RTN3/HAP using ab246911 (green) at 4 µg/ml in ICC/IF.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)

      Paraffin-embedded human cerebral cortex tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)

      Paraffin-embedded human colon tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis. No positivity in glandular cells as expected.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)

      Paraffin-embedded human lymph node tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis. No positivity in lymphoid cells as expected.

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)

      Paraffin-embedded human liver tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis. No positivity in hepatocytes as expected.

    References

    ab246911 has not yet been referenced specifically in any publications.

    Publishing research using ab246911? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab246911.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com