Anti-RTN3/HAP antibody (ab246911)
Key features and details
- Rabbit polyclonal to RTN3/HAP
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-RTN3/HAP antibody
See all RTN3/HAP primary antibodies -
Description
Rabbit polyclonal to RTN3/HAP -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human RTN3/HAP aa 81-217.
Sequence:IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKM EKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQI DKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY
Database link: O95197 -
Positive control
- IHC-P: Human cerebral cortex tissue. ICC/IF: U-2 OS cells.
-
General notes
This product was previously labelled as RTN3
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab246911 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. -
Tissue specificity
Isoform 3 is widely expressed, with highest levels in brain, where it is enriched in neuronal cell bodies from gray matter (at protein level). Three times more abundant in macula than in peripheral retina. Isoform 1 is expressed at high levels in brain and at low levels in skeletal muscle. Isoform 2 is only found in melanoma. -
Sequence similarities
Contains 1 reticulon domain. -
Cellular localization
Endoplasmic reticulum membrane. Golgi apparatus membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10313 Human
- Omim: 604249 Human
- SwissProt: O95197 Human
- Unigene: 473761 Human
-
Alternative names
- ASYIP antibody
- Neuroendocrine specific protein like 2 antibody
- Neuroendocrine-specific protein-like 2 antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells stained for RTN3/HAP using ab246911 (green) at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
Paraffin-embedded human cerebral cortex tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
Paraffin-embedded human colon tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis. No positivity in glandular cells as expected.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
Paraffin-embedded human lymph node tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis. No positivity in lymphoid cells as expected.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RTN3/HAP antibody (ab246911)
Paraffin-embedded human liver tissue stained for RTN3/HAP using ab246911 at 1/50 dilution in immunohistochemical analysis. No positivity in hepatocytes as expected.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab246911 has not yet been referenced specifically in any publications.