Overview

  • Product name

    Anti-RTP3 antibody
  • Description

    Rabbit polyclonal to RTP3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human RTP3 aa 1-211.
    Sequence:

    MAGDTEVWKQMFQELMREVKPWHRWTLRPDKGLLPNVLKPGWMQYQQWTF ARFQCSSCSRNWASAQVLVLFHMNWSEEKSRGQVKMRVFTQRCKKCPQPL FEDPEFTQENISRILKNLVFRILKKCYRGRFQLIEEVPMIKDISLEGPHN SDNCEACLQGFCAGPIQVTSLPPSQTPRVHSIYKVEEVVKPWASGENVYS YACQNHICRNL


    Database link: Q9BQQ7

  • Positive control

    • WB: Mouse spleen, lung, kidney, brain and stomach tissue lysates. IHC-P: Human kidney tissue. IP: Mouse brain lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
WB 1/2000 - 1/8000. Predicted molecular weight: 27 kDa.

Target

Images

  • All lanes : Anti-RTP3 antibody (ab236886) at 1/2000 dilution

    Lane 1 : Mouse spleen tissue lysate
    Lane 2 : Mouse lung tissue lysate
    Lane 3 : Mouse kidney tissue lysate
    Lane 4 : Mouse brain tissue lysate
    Lane 5 : Mouse stomach tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 27 kDa

  • Paraffin-embedded human kidney tissue stained for RTP3 using ab236886 at 1/100 dilution in immunohistochemical analysis.

  • RTP3 was immunoprecipitated from 500 μg of mouse brain tissue lysate using ab236886 at 1/200 dilution. For western blotting, an HRP-conjugated light chain specific antibody was used as the secondary antibody at 1/50000 dilution.

    Lane 1: Rabbit control IgG instead of ab236886 in mouse brain lysate.

    Lane 2: ab236886 IP in mouse brain lysate.

    Lane 3: Mouse brain tissue lysate (10 μg) (input).

References

ab236886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up