Overview

  • Product name

  • Description

    Rabbit polyclonal to RUBISCO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Soybean
  • Immunogen

    Recombinant full length protein corresponding to Soybean RUBISCO aa 3-475.
    Sequence:

    PQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEE AGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVA YPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYIKTFQGPP HGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKD DENVNSQPFMRWRDRFLFCAEAIFKSQAETGEIKGHYLNATAGTCEEMMK RAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVID RQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGEREITLGFVDLLRDD FVEKDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQF GGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNEIIREASKWS PELAAACEVWKEIKFEFEAMDTL


    Database link: P27066

  • Positive control

    • WB: Recombinant Soybean RUBISCO protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab226002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 69 kDa (predicted molecular weight: 53 kDa).

Target

  • Function

    RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site.
  • Sequence similarities

    Belongs to the RuBisCO large chain family. Type I subfamily.
  • Post-translational
    modifications

    The disulfide bond which can form between Cys-247 in the large chain dimeric partners within the hexadecamer appears to be associated with oxidative stress and protein turnover (By similarity). The disulfide bonds reported in 1RBO may be the result of oxidation during crystallization.
  • Cellular localization

    Plastid > chloroplast.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3 phospho D glycerate carboxylase antibody
    • rbcL antibody
    • RBL_SPIOL antibody
    • Ribulose 1,5 bisphosphate carboxylase/oxygenase small subunit N methyltransferase I antibody
    • Ribulose bisphosphate carboxylase large chain antibody
    • RuBisCO large subunit antibody
    see all

Images

  • All lanes : Anti-RUBISCO antibody (ab226002) at 1/500 dilution

    Lane 1 : Recombinant Soybean RUBISCO protein at 0.08 µg
    Lane 2 : Recombinant Soybean RUBISCO protein at 0.04 µg
    Lane 3 : Recombinant Soybean RUBISCO protein at 0.02 µg
    Lane 4 : Recombinant Soybean RUBISCO protein at 0.01 µg

    Predicted band size: 53 kDa
    Observed band size: 69 kDa
    why is the actual band size different from the predicted?

References

ab226002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up