Overview

  • Product name

  • Description

    Rabbit polyclonal to RUFY2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human RUFY2 aa 396-655.
    Sequence:

    LIGLRQQLEEVKAINIEMYQKLQGSEDGLKEKNEIIARLEEKTNKITAAM RQLEQRLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLE TDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQIISLKKEFLNLQDENQQ LKKIYHEQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEATHC KLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHAL LIQRCSSNLP


    Database link: Q8WXA3-1

  • Positive control

    • WB: PC-3 whole cell lysate. IHC-P: Human testis and adrenal gland tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229924 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 75, 55, 49 kDa (predicted molecular weight: 76, 71, 75, 47, 44 kDa).
IHC-P 1/20 - 1/200.

Target

  • Relevance

    RUFY2 contains a N-terminal RUN domain, 2 central coiled-coil domains, and a C-terminal FYVE domain containing 2 zinc-binding sites and an SH3 domain recognition motif hence its name RUN and FYVE domain containing protein 2. RUFY2 is expressed in brain, lung, and testis only. RUFY2 reduced secretion of beta-amyloid from human embryonic kidney cells stably expressing APP. The RUFY2 gene maps to a region of chromosome 10q that has been linked to both late-onset Alzheimer disease and elevated plasma levels of pathogenic beta-amyloid. There are 2 isoforms produced by alternative splicing.
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • antigen MU RMS 40.17 antibody
    • FLJ10063 antibody
    • KIAA1537 antibody
    • rab4 interacting protein related antibody
    • RABIP4R antibody
    • RUN and FYVE domain containing 2 antibody
    • RUN and FYVE domain containing protein 2 antibody
    • ZFYVE1 antibody
    see all

Images

  • Anti-RUFY2 antibody (ab229924) at 1/1000 dilution + PC-3 (Human prostate adenocarcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 76, 71, 75, 47, 44 kDa

  • Paraffin-embedded human testis tissue stained for RUFY2 with ab229924 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for RUFY2 with ab229924 at a 1/100 dilution in immunohistochemical analysis.

References

ab229924 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229924.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up