For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    runx1--aml1-antibody-ab23980.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurology process Neurogenesis
Share by email

Anti-RUNX1 / AML1 antibody (ab23980)

  • Datasheet
Reviews (14)Q&A (9)References (126)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-RUNX1 / AML1 antibody (ab23980)
  • Immunocytochemistry/ Immunofluorescence - Anti-RUNX1 / AML1 antibody (ab23980)

Key features and details

  • Rabbit polyclonal to RUNX1 / AML1
  • Suitable for: WB
  • Reacts with: Human
  • Isotype: IgG

Get better batch-to-batch reproducibility with a recombinant antibody

Product image
Anti-RUNX1 / AML1 + RUNX3 + RUNX2 antibody [EPR3098] (ab133261)
  • Research with confidence – consistent and reproducible results with every batch
  • Long-term and scalable supply – powered by recombinant technology for fast production
  • Success from the first experiment – confirmed specificity through extensive validation
  • Ethical standards compliant – production is animal-free

Overview

  • Product name

    Anti-RUNX1 / AML1 antibody
    See all RUNX1 / AML1 primary antibodies
  • Description

    Rabbit polyclonal to RUNX1 / AML1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide corresponding to Human RUNX1/ AML1 aa 200-300 conjugated to keyhole limpet haemocyanin.
    (Peptide available as ab24287)

  • General notes

    Antibody batches of a concentration <1mg/ml will have BSA added to them.

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.

    If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Neuroscience
    • Neurology process
    • Neurogenesis
    • Epigenetics and Nuclear Signaling
    • Transcription
    • Other factors
    • Stem Cells
    • Hematopoietic Progenitors
    • Intracellular Molecules
    • Epigenetics and Nuclear Signaling
    • Chromatin Binding Proteins
    • DNA / RNA binding
    • Cancer
    • Oncoproteins/suppressors
    • Oncoproteins
    • Transcription factors
    • Stem Cells
    • Hematopoietic Progenitors
    • Hemangioblast
    • Developmental Biology
    • Organogenesis
    • Hematopoietic system development

Associated products

  • ChIP Related Products

    • ChIP Kit (ab500)
  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant Human RUNX1 / AML1 protein (ab134873)
  • Related Products

    • Prestained Protein Ladder – Broad molecular weight (10-245 kDa) (ab116028)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab23980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB (6)
Use a concentration of 1 µg/ml. Detects a band of approximately 52 kDa (predicted molecular weight: 48 kDa).
Notes
WB
Use a concentration of 1 µg/ml. Detects a band of approximately 52 kDa (predicted molecular weight: 48 kDa).

Target

  • Function

    CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation.
  • Tissue specificity

    Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
  • Involvement in disease

    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of M2 type acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1T1.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of therapy-related myelodysplastic syndrome (T-MDS). Translocation t(3;21)(q26;q22) with EAP or MECOM.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with EAP or MECOM.
    Note=A chromosomal aberration involving RUNX1/AML1 is found in childhood acute lymphoblastic leukemia (ALL). Translocation t(12;21)(p13;q22) with TEL. The translocation fuses the 3'-end of TEL to the alternate 5'-exon of AML-1H.
    Note=A chromosomal aberration involving RUNX1 is found in acute leukemia. Translocation t(11,21)(q13;q22) that forms a MACROD1-RUNX1 fusion protein.
    Defects in RUNX1 are the cause of familial platelet disorder with associated myeloid malignancy (FPDMM) [MIM:601399]. FPDMM is an autosomal dominant disease characterized by qualitative and quantitative platelet defects, and propensity to develop acute myelogenous leukemia.
    Note=A chromosomal aberration involving RUNX1/AML1 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein.
    Note=A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelomonocytic leukemia. Inversion inv(21)(q21;q22) with USP16.
  • Sequence similarities

    Contains 1 Runt domain.
  • Domain

    A proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes.
  • Post-translational
    modifications

    Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.
    Methylated.
  • Cellular localization

    Nucleus.
  • Target information above from: UniProt accession Q01196 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 861 Human
    • Entrez Gene: 50662 Rat
    • Omim: 151385 Human
    • SwissProt: Q01196 Human
    • SwissProt: Q63046 Rat
    • Unigene: 149261 Human
    • Unigene: 612648 Human
    • Unigene: 11201 Rat
    • Alternative names

      • Acute myeloid leukemia 1 antibody
      • Acute myeloid leukemia 1 protein antibody
      • alpha subunit core binding factor antibody
      • AML 1 antibody
      • AML1 antibody
      • AML1 EVI 1 antibody
      • AML1 EVI 1 fusion protein antibody
      • Aml1 oncogene antibody
      • AMLCR 1 antibody
      • AMLCR1 antibody
      • CBF alpha 2 antibody
      • CBF-alpha-2 antibody
      • CBFA 2 antibody
      • CBFA2 antibody
      • Core binding factor alpha 2 subunit antibody
      • Core binding factor runt domain alpha subunit 2 antibody
      • Core-binding factor subunit alpha-2 antibody
      • EVI 1 antibody
      • EVI1 antibody
      • HGNC antibody
      • Oncogene AML 1 antibody
      • Oncogene AML-1 antibody
      • OTTHUMP00000108696 antibody
      • OTTHUMP00000108697 antibody
      • OTTHUMP00000108699 antibody
      • OTTHUMP00000108700 antibody
      • OTTHUMP00000108702 antibody
      • PEA2 alpha B antibody
      • PEA2-alpha B antibody
      • PEBP2 alpha B antibody
      • PEBP2-alpha B antibody
      • PEBP2A2 antibody
      • PEBP2aB antibody
      • Polyomavirus enhancer binding protein 2 alpha B subunit antibody
      • Polyomavirus enhancer-binding protein 2 alpha B subunit antibody
      • Run1 antibody
      • Runt related transcription factor 1 antibody
      • Runt-related transcription factor 1 antibody
      • RUNX 1 antibody
      • Runx1 antibody
      • RUNX1_HUMAN antibody
      • SL3 3 enhancer factor 1 alpha B subunit antibody
      • SL3-3 enhancer factor 1 alpha B subunit antibody
      • SL3/AKV core binding factor alpha B subunit antibody
      • SL3/AKV core-binding factor alpha B subunit antibody
      see all

    Images

    • Western blot - Anti-RUNX1 / AML1 antibody (ab23980)
      Western blot - Anti-RUNX1 / AML1 antibody (ab23980)
      Anti-RUNX1 / AML1 antibody (ab23980) at 1 µg/ml + Jurkat nuclear extract lysate (ab14844) at 20 µg

      Secondary
      Rabbit IgG secondary antibody (ab28446) at 1/10000 dilution

      Predicted band size: 48 kDa
      Observed band size: 48,52,55 kDa why is the actual band size different from the predicted?



      This antibody recognized three distinct bands of between 48 and 55 kDa in Jurkat nuclear lysate. These may represent distinct isoforms of Runx1 or may represent post-translationally modified forms.
    • Immunocytochemistry/ Immunofluorescence - Anti-RUNX1 / AML1 antibody (ab23980)
      Immunocytochemistry/ Immunofluorescence - Anti-RUNX1 / AML1 antibody (ab23980)Image courtesy of an anonymous Abreview.
      ab23980 staining RUNX1 / AML1 in human glioblastoma cells by Immunocytochemistry/ Immunofluorescence. The cells were fixed in paraformaldehyde, permeabilised in 0.1% Triton X-100 and then blocked using 0.5% BSA for 20 minutes. Samples were then incubated with primary antibody at 1/50 for 16 hours at 4°C. The secondary antibody used was a goat anti-rabbit IgG conjugated to Cy3® used at a 1/400 dilution.

    Protocols

    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (126)

    Publishing research using ab23980? Please let us know so that we can cite the reference in this datasheet.

    ab23980 has been referenced in 126 publications.

    • Kellaway SG  et al. Different mutant RUNX1 oncoproteins program alternate haematopoietic differentiation trajectories. Life Sci Alliance 4:N/A (2021). PubMed: 33397648
    • Li M  et al. Core transcription regulatory circuitry orchestrates corneal epithelial homeostasis. Nat Commun 12:420 (2021). PubMed: 33462242
    • Tang CY  et al. Runx1 is a central regulator of osteogenesis for bone homeostasis by orchestrating BMP and WNT signaling pathways. PLoS Genet 17:e1009233 (2021). PubMed: 33476325
    • Malik N  et al. CBFB cooperates with p53 to maintain TAp73 expression and suppress breast cancer. PLoS Genet 17:e1009553 (2021). PubMed: 33945523
    • Ren S  et al. MiR-18a Aggravates Intracranial Hemorrhage by Regulating RUNX1-Occludin/ZO-1 Axis to Increase BBB Permeability. J Stroke Cerebrovasc Dis 30:105878 (2021). PubMed: 34077824
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a question

    1-9 of 9 Q&A

    Question



    Thank you for the information. I was also wondering if this antibody has been tested to bind Runx2 and Runx3 because I would like this to be very specific to Runx1. In particular, may I know if the immunogen is within this sequence fragment (which is quite conserved among other Runx proteins):


    Read More

    Abcam community

    Verified customer

    Asked on Jan 21 2013

    Answer

    Hello!

    The immunogen sequence has only 70% homology with RUNX2 and no significant similarity with RUNX3 and is very unlikely to cross-react. Usually around 85% there is cross-reactivity. Please let me know if I can be of further assistance.

    Read More

    Abcam Scientific Support

    Answered on Jan 21 2013

    Question

    Dear Abcam, I am interested to buy Runx1 antibody (ab23980). Human Runx1 has several isoforms. I was wondering if the product's immunogen "synthetic peptide conjugated to KLH derived from within residues 200-300 of Human Runx1/AML1" refers to this sequence: ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDARQIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTSLSAELSSRLSTAPD or it would be great if there is a specific sequence that you can provide. I need Runx1 antibody that will bind to an un-tagged mouse Runx1.

    Read More

    Abcam community

    Verified customer

    Asked on Jan 21 2013

    Answer

    Thank you for contacting us. The actual immunogen is a smaller peptide within that sequence. The tag is for purification purposes but it is not necessary that your samples have a tag for Runx1 to be detected. This antibody has been tested for use in mouse.


    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Jan 21 2013

    Question

    Spurious results in ChIP and in WB antibody is recognizing a band at 100/150kDa, instead of 50kDa.

    Read More

    Abcam community

    Verified customer

    Asked on Jul 16 2012

    Answer

    Thank you for contacting Abcam.

    As we discussed, I am sending you a Jurkat cell lysate to use as a positive control with ab23980 to check if the antibody is working correctly. You should receive this lysate on Friday and your order number is *
    .

    If there is anything else I can help you with, or if you have any other issues with the antibody, please let me know.

    Read More

    Abcam Scientific Support

    Answered on Jul 16 2012

    Question

    No siganl in western blot.

    Read More

    Abcam community

    Verified customer

    Asked on May 04 2012

    Answer

    Thank you for contacting Abcam earlier today.

    I received your voicemail about the lot number that your colleague was sent. We are out of stock of that particular lot number, but if you have any issues whatsoever with the vial that we are sending you, please let me know and I will be happy to help resolve this issue for you.

    Hope you have a nice weekend.

    Read More

    Abcam Scientific Support

    Answered on May 04 2012

    Question

    Thanks for your quick response and kind offer. Please see the attached packslip for the previous order. I will definitely test out the Ab with the new lot. Thanks again for all your help.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 03 2012

    Answer

    Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.

    To check the status of the order please contact our Customer Service team and reference this number.

    Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know.

    I wish you the best of luck with your research.

    Read More

    Abcam Scientific Support

    Answered on Apr 03 2012

    Question

    We just bought your product ab23980 for western blotting mouse RUNX1 protein. We used 293T cells transfected with myc-RUNX1 plasmid. While anti-myc can detect the protein well, the anti-RUNX1 antibody (ab23980) gave dark background at dilution of 1:1000 and 1:5000 within 15 sec exposure. The background is too dark to see any band if any.

    We used 10% NuPAGE gel to separate the protein lysate , used iblot to transfer protein to PDVF membrane, and 5% milk (biorad) in PBST to block the PDVF membrane. Our 2nd Ab woked well with a different product from your company (abcam 11905).

    Do you have any suggestions to lower the background?

    Read More

    Abcam community

    Verified customer

    Asked on Apr 03 2012

    Answer

    Thank you for bringing this to our attention. I think your protocol with the dilutions you are using should not be giving you high background, especially if the myc western blot demonstrates that the samples are not degraded.

    We have a new lot of the antibody which I will be happy to send free-of-charge. Please let me know if you are interested in receiving a vial of the new lot.

    Read More

    Abcam Scientific Support

    Answered on Apr 03 2012

    Question

    1) Abcam product code ab 23980
    2) Abcam order reference number or product batch number
    3) Description of the problem: no band
    4) Sample preparation:
    Type of sample (whole cell lysates, fraction, recombinant protein…): nuclues vs cytoplasme
    Species : Human samples (patients or cell line)
    Lysis buffer : RIPA
    Protease inhibitors: kit roche complete + PMSF + AEBSF
    Phosphatase inhibitors : No
    Reducing agent :b-mercapto
    Boiling for ≥5 min? 5 min
    Protein loaded ug/lane or cells/lane : 2millions cells
    Positive control : ME1
    Negative control : No
    5) Percentage of gel 12%
    Type of membrane nitrocellulose
    Protein transfer verifiedSee massruller
    Blocking agent and concentration
    Blocking time No blocking
    Blocking temperature
    6) Primary antibody (If more than one was used, describe in “additional notes”) :
    Concentration or dilution 1/1000
    Diluent buffer Non fat milk 5%
    Incubation time onvernight
    Incubation temperature: 4°C
    7) Secondary antibody:
    Species:
    Reacts against: Rabbit
    Concentration or dilution 1/20000
    Diluent buffer Non fat milk 5%
    Incubation time 30 minutes
    Incubation temperature: RT
    Fluorochrome or enzyme conjugate: HRP
    8) Washing after primary and secondary antibodies:
    Buffer TPBS
    Number of washes 3
    9)Detection method West DUra HRP
    10) How many times have you run this staining? 3
    Do you obtain the same results every time? yes
    What steps have you altered to try and optimize the use of this antibody?
    Document attachment: Attaching images of your blot is strongly recommended and can greatly speed up our investigation of your problem.

    Read More

    Abcam community

    Verified customer

    Asked on Feb 06 2012

    Answer

    Merci beaucoup pour ces précisions.

    N'hésitez pas à nous contacter de nouveau si vous avez d'autres questions.

    Read More

    Abcam Scientific Support

    Answered on Feb 06 2012

    Question

    problème avec le dernier lot de ab23980 reçu (1071842 GR37372-1).
    WB et ChIP

    Read More

    Abcam community

    Verified customer

    Asked on Feb 03 2012

    Answer

    Suite à mon précédent email, pourriez-vous, s'il vous plait, nous communiquer quelques détails concernant votre protocole en remplissant le questionnaire ci-joint. Ces informations sont très importantes pour nous car elles nous permettent d'investiguer la source du problème rencontré avec cet anticorps et de prendre les dispositions nécessaires pour assurer une bonne qualité de nos produits.

    Merci et bon week-end.

    Read More

    Abcam Scientific Support

    Answered on Feb 03 2012

    Question

    problème avec le dernier lot de ab23980 reçu (1071842 GR37372-1).
    WB et ChIP

    Read More

    Abcam community

    Verified customer

    Asked on Feb 03 2012

    Answer

    Merci de nous avoir contactés.

    Nous sommes désolés d'apprendre que le produit ab23980 lot GR37372-1 que vous avez reçu ne fonctionne pas comme attendu.

    Le numéro de commande de remplacement gratuit de ce produit est *****. Vous recevrez prochainement un mail de confirmation comprenant les détails d'expédition.

    N'hésitez pas à nous contacter lors d'une prochaine occasion.

    Read More

    Abcam Scientific Support

    Answered on Feb 03 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.