Overview

  • Product name

    Anti-RUNX1T1/ETO/CDR antibody
    See all RUNX1T1/ETO/CDR primary antibodies
  • Description

    Rabbit polyclonal to RUNX1T1/ETO/CDR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human RUNX1T1/ETO/CDR aa 404-450.
    Sequence:

    KGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAE


    Database link: Q06455

  • Positive control

    • HEK 293 cells.
  • General notes

     This product was previously labelled as RUNX1T1 / ETO

     

Properties

Applications

Our Abpromise guarantee covers the use of ab220347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcription regulator that excerts its function by binding to histone deacetylases and transcription factors. Can repress transactivation mediated by TCF12.
  • Tissue specificity

    Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary.
  • Involvement in disease

    Note=A chromosomal aberration involving RUNX1T1 is a cause of acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1/AML1.
    Defects in RUNX1T1 may be a cause of colorectal cancer (CRC) [MIM:114500].
  • Sequence similarities

    Belongs to the CBFA2T family.
    Contains 1 MYND-type zinc finger.
    Contains 1 TAFH (NHR1) domain.
  • Domain

    The TAFH domain mediates interaction with transcription regulators.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acute myelogenous leukemia 1 translocation 1 cyclin D related antibody
    • Acute myelogenous leukemia 1 translocation 1 protein antibody
    • AML1 MTG8 antibody
    • AML1T1 antibody
    • CBFA2T1 antibody
    • CDR antibody
    • Core binding factor runt domain alpha subunit 2 translocated to 1 antibody
    • Core binding factor runt domain alpha subunit 2 translocated to 1 cyclin D related antibody
    • Cyclin D related antibody
    • Cyclin D related protein antibody
    • Cyclin-D-related protein antibody
    • Eight twenty one protein antibody
    • ETO antibody
    • ETO protein antibody
    • MGC2796 antibody
    • MTG 8 antibody
    • MTG 8b antibody
    • MTG8 antibody
    • MTG8 protein antibody
    • MTG8_HUMAN antibody
    • MTG8b antibody
    • Myeloid translocation gene on 8q22 antibody
    • Protein CBFA2T1 antibody
    • Protein ETO antibody
    • Protein MTG 8 antibody
    • Protein MTG8 antibody
    • Runt related transcription factor 1 translocated to 1 (cyclin D related) antibody
    • Runt related transcription factor 1 translocated to 1 antibody
    • Runt related transcription factor 1 translocated to 1 cyclin D related antibody
    • RUNX1 translocation partner 1 antibody
    • RUNX1T1 antibody
    • Zinc finger MYND domain containing protein 2 antibody
    • Zinc finger MYND domain-containing protein 2 antibody
    • ZMYND 2 antibody
    • ZMYND2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HEK 293 cells labeling RUNX1T1/ETO/CDR with ab220347 at 4 μg/ml (green).

References

ab220347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up