Overview

  • Product name

  • Description

    Rabbit polyclonal to RVR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human RVR aa 193-290.
    Sequence:

    SAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKSSS PPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKN


    Database link: Q14995

  • Positive control

    • Human rectum tissue.
  • General notes

    Protein previously labeled as NR1D2.

Properties

Applications

Our Abpromise guarantee covers the use of ab188076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Binds to the sequences 5'-AATGTAGGTCA-3' and 5'-ATAACTAGGTCA-3'. Acts as a potent competitive repressor of ROR alpha function.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • BD73 antibody
    • EAR 1R antibody
    • EAR-1R antibody
    • HZF2 antibody
    • Nr1d2 antibody
    • NR1D2_HUMAN antibody
    • Nuclear receptor Rev ErbA beta variant 1 antibody
    • Nuclear receptor Rev ErbA beta variant 2 antibody
    • Nuclear receptor subfamily 1 group D member 2 antibody
    • Orphan nuclear hormone receptor BD73 antibody
    • Rev erb beta antibody
    • Rev erba alpha related receptor antibody
    • Rev-erb-beta antibody
    • REVB antibody
    • REVERBB antibody
    • RVR antibody
    • V-erbA-related protein 1-related antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue labeling RVR with ab188076 at 1/500 dilution.

References

ab188076 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Pig Tissue sections (Liver pig)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citratbuffer ph 6
Permeabilization
No
Specification
Liver pig
Blocking step
commercial blocking solution (according to the manufacturer's instructions zytomed) as blocking agent for 5 minute(s) · Concentration: 3% · Temperature: RT°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted May 18 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up