Overview

  • Product name

    Anti-RWDD2A antibody
  • Description

    Rabbit polyclonal to RWDD2A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human RWDD2A aa 1-292.
    Sequence:

    MSASVKESLQLQLLEMEMLFSMFPNQGEVKLEDVNALTNIKRYLEGTREA LPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVALQLFGRSSELDRHQQL LLNKGLTSYIGTFDPGELCVCAAIQWLQDNSASYFLNRKLVYEPSTQAKP VKNTFLRMWIYSHHIYQQDLRKKILDVGKRLDVTGFCMTGKPGIICVEGF KEHCEEFWHTIRYPNWKHISCKHAESVETEGNGEDLRLFHSFEELLLEAH GDYGLRNDYHMNLGQFLEFLKKHKSEHVFQILFGIESKSSDS


    Database link: Q9UIY3

  • Positive control

    • WB: Mouse thymus lysate; A549 whole cell lysate. IHC-P: Human small intestine tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • All lanes : Anti-RWDD2A antibody (ab235309) at 1/500 dilution

    Lane 1 : Mouse thymus lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 33 kDa

  • Paraffin-embedded human small intestine tissue stained for RWDD2A using ab235309 at 1/100 dilution in immunohistochemical analysis.

References

ab235309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up