Anti-Ryanodine receptor 1 antibody (ab224582)

Overview

  • Product name

    Anti-Ryanodine receptor 1 antibody
  • Description

    Rabbit polyclonal to Ryanodine receptor 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Pig
  • Immunogen

    Recombinant fragment corresponding to Human Ryanodine receptor 1 aa 3550-3617.
    Sequence:

    REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEV SAVLYYLDQTEHPYKSKK


    Database link: P21817

  • Positive control

    • IHC-P: Human cerebellum tissue. ICC/IF: SiHa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab224582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm and thereby plays a key role in triggering muscle contraction following depolarization of T-tubules. Repeated very high-level exercise increases the open probability of the channel and leads to Ca(2+) leaking into the cytoplasm. Can also mediate the release of Ca(2+) from intracellular stores in neurons, and may thereby promote prolonged Ca(2+) signaling in the brain. Required for normal embryonic development of muscle fibers and skeletal muscle. Required for normal heart morphogenesis, skin development and ossification during embryogenesis.
  • Tissue specificity

    Skeletal muscle and brain (cerebellum and hippocampus).
  • Involvement in disease

    Malignant hyperthermia 1
    Central core disease of muscle
    Multiminicore disease with external ophthalmoplegia
    Defects in RYR1 may be a cause of Samaritan myopathy, a congenital myopathy with benign course. Patients display severe hypotonia and respiratory distress at birth. Unlike other congenital myopathies, the health status constantly improves and patients are minimally affected at adulthood.
  • Sequence similarities

    Belongs to the ryanodine receptor (TC 1.A.3.1) family. RYR1 subfamily.
    Contains 3 B30.2/SPRY domains.
    Contains 5 MIR domains.
  • Domain

    The calcium release channel activity resides in the C-terminal region while the remaining part of the protein constitutes the 'foot' structure spanning the junctional gap between the sarcoplasmic reticulum (SR) and the T-tubule.
  • Post-translational
    modifications

    Channel activity is modulated by phosphorylation. Phosphorylation at Ser-2843 may increase channel activity. Repeated very high-level exercise increases phosphorylation at Ser-2843.
    Activated by reversible S-nitrosylation. Repeated very high-level exercise increases S-nitrosylation.
  • Cellular localization

    Sarcoplasmic reticulum membrane. Membrane. Sarcoplasmic reticulum. The number of predicted transmembrane domains varies between orthologs, but both N-terminus and C-terminus seem to be cytoplasmic.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCO antibody
    • Central core disease of muscle antibody
    • MHS antibody
    • MHS1 antibody
    • PPP1R137 antibody
    • Protein phosphatase 1 regulatory subunit 137 antibody
    • Ryanodine receptor 1 antibody
    • RYDR antibody
    • RYR antibody
    • RYR-1 antibody
    • RyR1 antibody
    • RYR1_HUMAN antibody
    • sarcoplasmic reticulum calcium release channel antibody
    • Skeletal muscle calcium release channel antibody
    • Skeletal muscle ryanodine receptor antibody
    • Skeletal muscle-type ryanodine receptor antibody
    • SKRR antibody
    • Type 1 ryanodine receptor antibody
    see all

Images

  • Paraffin-embedded human cerebellum tissue stained for Ryanodine receptor 1 using ab224582 at 1/20 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized SiHa cells stained for Ryanodine receptor 1 (green) using ab224582 at 4 µg/ml in ICC/IF.

References

ab224582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up