Overview

  • Product name

    Anti-S100 alpha 2/S100A2 antibody
    See all S100 alpha 2/S100A2 primary antibodies
  • Description

    Rabbit polyclonal to S100 alpha 2/S100A2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human S100 alpha 2/S100A2 aa 34-72.
    Sequence:

    EMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVD


    Database link: P29034

  • Positive control

    • WB: RT4 cell lysate. IHC-P: Human esophagus tissue.
  • General notes

     This product was previously labelled as S100 alpha 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244524 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.

Target

  • Function

    May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.
  • Tissue specificity

    A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Developmental stage

    Preferentially expressed in normal human mammary epithelial cells as opposed to tumor-derived ones. The level of S100L was shown to correlate inversely with tumor progression.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAN19 antibody
    • MGC111539 antibody
    • Protein S 100L antibody
    • Protein S-100L antibody
    • Protein S100 A2 antibody
    • Protein S100-A2 antibody
    • Protein S100L antibody
    • S100 A2 antibody
    • S100 calcium binding protein A2 antibody
    • S100 calcium-binding protein A2 antibody
    • S100A2 antibody
    • S100L antibody
    • S10A2_HUMAN antibody
    see all

Images

  • Paraffin-embedded human esophagus tissue stained for S100 alpha 2/S100A2 using ab244524 at 1/500 dilution in immunohistochemical analysis.

  • Paraffin-embedded human stomach tissue stained for S100 alpha 2/S100A2 using ab244524 at 1/500 dilution in immunohistochemical analysis.

    Low expression as expected.

  • Anti-S100 alpha 2/S100A2 antibody (ab244524) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate

References

ab244524 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244524.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up