Overview

  • Product name

    Anti-S100 alpha antibody [S1/61] - BSA and Azide free
    See all S100 alpha primary antibodies
  • Description

    Mouse monoclonal [S1/61] to S100 alpha - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Full length protein corresponding to Human S100 alpha aa 1-94 conjugated to bovine serum albumin. (Purified S100 alpha conjugated to methylated BSA).
    Sequence:

    MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQK DVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS


    Database link: P23297

  • Positive control

    • IHC-P: Human melanoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Purification notes

    Purified from Bioreactor Concentrate by Protein A/G.
  • Clonality

    Monoclonal
  • Clone number

    S1/61
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Primary incubation for 30 minutes at room temperature.

Target

  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites.
  • Tissue specificity

    Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Bpb antibody
    • NEF antibody
    • Protein S100-A1 antibody
    • S-100 protein alpha chain antibody
    • S-100 protein subunit alpha antibody
    • S100 alpha antibody
    • S100 Alpha Chain antibody
    • S100 antibody
    • S100 Beta Chain antibody
    • S100 Calcium Binding Protein A1 antibody
    • S100 Calcium Binding Protein B antibody
    • S100 Calcium Binding Protein Beta Neural antibody
    • S100 calcium-binding protein A1 antibody
    • S100 protein alpha polypeptide antibody
    • S100A antibody
    • s100a1 antibody
    • S10A1_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human melanoma tissue stained for S100 alpha using ab233964 at 2 μg/ml in immunohistochemical analysis.

References

ab233964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up