Anti-S100 beta antibody (ab227914)

Rabbit polyclonal S100 beta antibody. Validated in WB, IHC and tested in Mouse, Rat, Human. Immunogen corresponding to recombinant full length protein.

Overview

  • Product name

  • Description

    Rabbit polyclonal to S100 beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IHC-Frmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit, Cow, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human S100 beta aa 1-92.
    Sequence:

    MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE


    Database link: P04271

  • Positive control

    • WB: S100 beta transfected HEK-293T whole cell extracts; A-375 whole cell extracts; Mouse and rat brain tissue extracts. IHC-P: Mouse hind brain tissue. IHC-Fr: Adult mouse retina tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab227914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/1000.
WB 1/500 - 1/3000. Predicted molecular weight: 11 kDa.
IHC-Fr 1/100 - 1/1000.

Target

  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity

    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NEF antibody
    • Protein S100 B antibody
    • Protein S100-B antibody
    • S 100 calcium binding protein beta chain antibody
    • S 100 protein beta chain antibody
    • S-100 protein beta chain antibody
    • S-100 protein subunit beta antibody
    • S100 antibody
    • S100 calcium binding protein beta (neural) antibody
    • S100 calcium-binding protein B antibody
    • S100 protein beta chain antibody
    • S100B antibody
    • S100B_HUMAN antibody
    • S100beta antibody
    see all

Images

  • Frozen sections of adult mouse retina tissue stained for S100 beta using ab227914 at 1/250 dilution in immunohistochemical analysis.

    Counter stain: beta Tubulin 3/ TUJ1, stained by beta Tubulin 3/ TUJ1 antibody at 1/250 dilution (red).
    Nuclear counter stain: Fluoroshield with DAPI (blue).

  • All lanes : Anti-S100 beta antibody (ab227914) at 1/1000 dilution

    Lane 1 : Non-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell extract
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) transfected with V5-human S100 beta, whole cell extract

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 11 kDa



    15% SDS-PAGE gel.

  • Paraffin-embedded mouse hind brain tissue stained for S100 beta using ab227914 at 1/500 dilution in immunohistochemical analysis.

  • Anti-S100 beta antibody (ab227914) at 1/500 dilution + A-375 (human malignant melanoma cell line) whole cell extract at 30 µg

    Predicted band size: 11 kDa



    15% SDS-PAGE gel.

  • Anti-S100 beta antibody (ab227914) at 1/1000 dilution + Mouse brain tissue extract at 50 µg

    Predicted band size: 11 kDa



    15% SDS-PAGE gel.

  • Anti-S100 beta antibody (ab227914) at 1/1000 dilution + Rat brain tissue extract at 50 µg

    Predicted band size: 11 kDa



    15% SDS-PAGE gel.

References

ab227914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up