Overview

  • Product name

    Anti-S100 beta antibody [S100B/1012]
    See all S100 beta primary antibodies
  • Description

    Mouse monoclonal [S100B/1012] to S100 beta
  • Host species

    Mouse
  • Tested applications

    Suitable for: Protein Array, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human S100 beta aa 1-92.
    Sequence:

    MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE QEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE


    Database link: P04271

  • Positive control

    • Human melanoma and schwanoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab218515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Protein Array Use at an assay dependent concentration.
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity

    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NEF antibody
    • Protein S100 B antibody
    • Protein S100-B antibody
    • S 100 calcium binding protein beta chain antibody
    • S 100 protein beta chain antibody
    • S-100 protein beta chain antibody
    • S-100 protein subunit beta antibody
    • S100 antibody
    • S100 calcium binding protein beta (neural) antibody
    • S100 calcium-binding protein B antibody
    • S100 protein beta chain antibody
    • S100B antibody
    • S100B_HUMAN antibody
    • S100beta antibody
    see all

Images

  • ab218515 was tested in protein array against over 19000 different full-length human proteins.
    Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProtTM array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProtTM are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target.
    A MAb is specific to its intended target if the MAb has an S-score of at least 2.5. For example, if a MAb binds to protein X with a Z-score of 43 and to protein Y with a Z-score of 14, then the S-score for the binding of that MAb to protein X is equal to 29.
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human melanoma tissue labeling S100 beta with ab218515 at 0.5 µg/mL.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human schwanoma tissue labeling S100 beta with ab218515 at 0.5 µg/mL.

References

This product has been referenced in:

  • Park J  et al. A 3D human triculture system modeling neurodegeneration and neuroinflammation in Alzheimer's disease. Nat Neurosci 21:941-951 (2018). Human . Read more (PubMed: 29950669) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up