Overview

  • Product name

    Anti-S100 beta antibody [SPM354]
    See all S100 beta primary antibodies
  • Description

    Mouse monoclonal [SPM354] to S100 beta
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow
  • Immunogen

    Full length native protein (purified) corresponding to Cow S100 beta aa 2-92. (Purified from bovine brain).
    Sequence:

    SELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQ EVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE


    Database link: P02638

  • Positive control

    • Human melanoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218514 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling.
  • Tissue specificity

    Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NEF antibody
    • Protein S100 B antibody
    • Protein S100-B antibody
    • S 100 calcium binding protein beta chain antibody
    • S 100 protein beta chain antibody
    • S-100 protein beta chain antibody
    • S-100 protein subunit beta antibody
    • S100 antibody
    • S100 calcium binding protein beta (neural) antibody
    • S100 calcium-binding protein B antibody
    • S100 protein beta chain antibody
    • S100B antibody
    • S100B_HUMAN antibody
    • S100beta antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human melanoma tissue labeling S100 beta with ab218514 at 1 µg/mL.

References

ab218514 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218514.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up