Overview

  • Product name

    Anti-S100 Calcium Binding Protein A13/S100A13 antibody
    See all S100 Calcium Binding Protein A13/S100A13 primary antibodies
  • Description

    Rabbit polyclonal to S100 Calcium Binding Protein A13/S100A13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human S100 Calcium Binding Protein A13/S100A13 aa 65-95 (C terminal) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VNQDSELKFNEYWRLIGELAKEIRKKKDLKI


    Database link: Q99584

  • Positive control

    • Human gastric carcinoma and mouse heart tissues.
  • General notes

     This product was previously labelled as S100 Calcium Binding Protein A13

     

Properties

Applications

Our Abpromise guarantee covers the use of ab214190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.
  • Tissue specificity

    Expressed in heart and skeletal muscle.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Cytoplasm. Secreted. Secretion is mediated by exposure to stress and requires copper ions.
  • Information by UniProt
  • Database links

  • Alternative names

    • Protein S100 A13 antibody
    • Protein S100-A13 antibody
    • S100 calcium binding protein A13 antibody
    • S100 calcium-binding protein A13 antibody
    • S100a13 antibody
    • S10AD_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded mouse heart tissue labeling S100 Calcium Binding Protein A13/S100A13 with ab214190 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of Formalin-fixed, paraffin-embedded Human gastric carcinoma tissue labeling S100 Calcium Binding Protein A13/S100A13 with ab214190 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab214190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up