Overview

  • Product name

  • Description

    Rabbit polyclonal to S100A10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human S100A10 aa 1-97.
    Sequence:

    MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK


    Database link: P60903

  • Positive control

    • SW480, PC3 and HT29 cell extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab187201 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 11 kDa.
IHC-P 1/50 - 1/200.

Target

  • Function

    Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
  • Sequence similarities

    Belongs to the S-100 family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 42C antibody
    • AA409961 antibody
    • AL024248 antibody
    • Annexin II ligand antibody
    • Annexin II ligand, calpactin I, light polypeptide antibody
    • Annexin II tetramer (AIIt) p11 subunit antibody
    • Annexin II, light chain antibody
    • ANX2L antibody
    • ANX2LG antibody
    • Ca[1] antibody
    • CAL12 antibody
    • CAL1L antibody
    • Calpactin I light chain antibody
    • Calpactin I, p11 subunit antibody
    • Calpactin-1 light chain antibody
    • Cellular ligand of annexin II antibody
    • CLP11 antibody
    • GP11 antibody
    • MGC111133 antibody
    • Nerve growth factor-induced protein 42C antibody
    • OTTHUMP00000015269 antibody
    • OTTHUMP00000015270 antibody
    • p10 antibody
    • p10 protein antibody
    • p11 antibody
    • Protein S100 A10 antibody
    • Protein S100-A10 antibody
    • S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) antibody
    • S100 calcium binding protein A10 (calpactin) antibody
    • S100 calcium binding protein A10 antibody
    • S100 calcium-binding protein A10 antibody
    • S100a10 antibody
    • S10AA_HUMAN antibody
    see all

Images

  • All lanes : Anti-S100A10 antibody (ab187201) at 1/500 dilution

    Lane 1 : SW480 cell extract
    Lane 2 : PC3 cell extract
    Lane 3 : HT29 cell extract

    Predicted band size: 11 kDa

References

ab187201 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187201.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up