Overview

  • Product name

  • Description

    Rabbit polyclonal to S100A11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Chicken
  • Immunogen

    Recombinant full length protein corresponding to Chicken S100A11 aa 1-101. (N-terminal His-tag and GST-tag. Expressed in E.coli).
    Sequence:

    MSKVSPTETERCIESLLAVFQRYAGREGDNLKLSKKEFRTFMNTELASFT KNQKDPAVVDRMMKRLDINSDGQLDFQEFLNLIGGIAVACHDALLVQPPH P


    Database link: P24479

  • Positive control

    • WB: Recombinant chicken S100A11 protein; Chicken liver, spleen, heart and lung tissue lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231091 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 11 kDa.

Target

  • Function

    Facilitates the differentiation and the cornification of keratinocytes.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylation at Thr-10 by PRKCA significantly suppresses homodimerization and promotes association with NCL/nucleolin which induces nuclear translocation.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Calgizzarin antibody
    • Epididymis secretory protein Li 43 antibody
    • HEL S 43 antibody
    • Metastatic lymph node gene 70 protein antibody
    • MLN 70 antibody
    • MLN70 antibody
    • Protein S100 A11 antibody
    • Protein S100-A11 antibody
    • Protein S100-A11, N-terminally processed antibody
    • Protein S100-C antibody
    • Protein S100A11 antibody
    • Protein S100C antibody
    • S100 A11 antibody
    • S100 calcium binding protein A11 antibody
    • S100 calcium-binding protein A11 (calgizzarin) antibody
    • S100 calcium-binding protein A11 antibody
    • S100a11 antibody
    • S100C antibody
    • S10AB_HUMAN antibody
    see all

Images

  • Anti-S100A11 antibody (ab231091) at 2 µg/ml + Chicken spleen lysate

    Predicted band size: 11 kDa

  • Anti-S100A11 antibody (ab231091) at 2 µg + Chicken lung lysate

    Predicted band size: 11 kDa

  • Anti-S100A11 antibody (ab231091) at 2 µg/ml + Chicken heart lysate

    Predicted band size: 11 kDa

  • Anti-S100A11 antibody (ab231091) at 2 µg + Chicken liver lysate

    Predicted band size: 11 kDa

  • Anti-S100A11 antibody (ab231091) at 2 µg + Recombinant chicken S100A11 protein

    Predicted band size: 11 kDa

References

ab231091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up