Overview

  • Product name

    Anti-S100A12/CGRP antibody [19F5]
    See all S100A12/CGRP primary antibodies
  • Description

    Mouse monoclonal [19F5] to S100A12/CGRP
  • Host species

    Mouse
  • Specificity

    This antibody reacts specifically with the 10kDa human S100A12/CGRP protein. In WB the antibody show no cross reactivity with the following S100 protein family: A7, A8, A9 and A10. Other members of this S100 protein family have not been tested.

  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human S100A12/CGRP.

  • Positive control

    • Recombinant protein and on human neutrophils lysate.
  • General notes

     This product was previously labelled as S100A12

     

Properties

Applications

Our Abpromise guarantee covers the use of ab50250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 10 kDa.

Target

  • Function

    Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. Binds calcium, zinc and copper. Presence of zinc increases the affinity for calcium. Plays an important role in the inflammatory response. Interaction with AGER on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators.
  • Tissue specificity

    Monocytes and lymphocytes.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAAF1 antibody
    • CAGC antibody
    • Calcitermin antibody
    • Calcium-binding protein in amniotic fluid 1 antibody
    • Calgranulin C antibody
    • Calgranulin-C antibody
    • Calgranulin-related protein antibody
    • CGRP antibody
    • EN RAGE antibody
    • EN-RAGE antibody
    • ENRAGE antibody
    • Extracellular newly identified RAGE-binding protein antibody
    • migration inhibitory factor-related protein 6 antibody
    • MRP6 antibody
    • Neutrophil S100 protein antibody
    • p6 antibody
    • Protein S100 A12 antibody
    • S100 calcium binding protein A12 antibody
    • S100 calcium-binding protein A12 (calgranulin C) antibody
    • S100 calcium-binding protein A12 antibody
    • S100A12 antibody
    • S10AC_HUMAN antibody
    see all

References

ab50250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for your reply and for kindly confirming these details. No problem, I wanted to ensure I had the correct information so I could provide an accurate answer for you. I can confirm the following details regarding these products: ab103393 S100A12 protein: Recombinant full length Human S100A12 (amino acids 2-92) ab37657: The antibody is likely to detect ab103393 S100A12 protein, since the protein seuqence almost completely overlaps with the human S100A12 immunogen sequence for this antibody: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE ab50250 is a monoclonal raised against the whole length protein. I am sorry the epitope for this has not been mapped. However as it has been rasied against whole protein, I would suggest it should detect the full length recombinant protein. I would recommend also to consider that the protein ab103393 has a his tag. There is a small possibility the tag may interfere with antibody binding, and I am sorry we have no data to guarantee that the his tag will not prevent the binding of ab37657 or ab50250. I am sorry we have no other S100A12 proteins without his tag for you to try on this occasion. I hope this information will be helpful to you. Should you have any further questions, please do not hesitate to contact us.

Read More
Application
Western blot
Sample
Human Tissue lysate - whole (urine)
Loading amount
0.6 µg
Specification
urine
Gel Running Conditions
Reduced Denaturing (18% gel)
Blocking step
BSA as blocking agent for 12 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 4°C

Abcam user community

Verified customer

Submitted Jan 10 2011

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up