Overview

  • Product name

    Anti-S100A12/CGRP antibody
    See all S100A12/CGRP primary antibodies
  • Description

    Rabbit polyclonal to S100A12/CGRP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Pig
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Pig S100A12/CGRP aa 2-92. (expressed in E.coli)
    Sequence:

    TKLEDHLEGIINIFHQYSVRLGHYDTLIKRELKQLITKELPNTLKNTKDQ GTIDKIFQNLDANQDEQVSFKEFVVLVTDVLITAHDNIHKE


    Database link: P80310

  • Positive control

    • WB: Recombinant pig S100A12/CGRP protein; Pig lung and spleen lysates.
  • General notes

     This product was previously labelled as S100A12

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 11 kDa.

Target

  • Function

    Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. Binds calcium, zinc and copper. Presence of zinc increases the affinity for calcium. Plays an important role in the inflammatory response. Interaction with AGER on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators.
  • Tissue specificity

    Monocytes and lymphocytes.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAAF1 antibody
    • CAGC antibody
    • Calcitermin antibody
    • Calcium-binding protein in amniotic fluid 1 antibody
    • Calgranulin C antibody
    • Calgranulin-C antibody
    • Calgranulin-related protein antibody
    • CGRP antibody
    • EN RAGE antibody
    • EN-RAGE antibody
    • ENRAGE antibody
    • Extracellular newly identified RAGE-binding protein antibody
    • migration inhibitory factor-related protein 6 antibody
    • MRP6 antibody
    • Neutrophil S100 protein antibody
    • p6 antibody
    • Protein S100 A12 antibody
    • S100 calcium binding protein A12 antibody
    • S100 calcium-binding protein A12 (calgranulin C) antibody
    • S100 calcium-binding protein A12 antibody
    • S100A12 antibody
    • S10AC_HUMAN antibody
    see all

Images

  • All lanes : Anti-S100A12/CGRP antibody (ab231722) at 2 µg/ml

    Lane 1 : Pig spleen lysate
    Lane 2 : Pig lung lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution

    Predicted band size: 11 kDa

  • Anti-S100A12/CGRP antibody (ab231722) at 2 µg/ml + Recombinant pig S100A12/CGRP protein.

    Predicted band size: 11 kDa

  • Anti-S100A12/CGRP antibody (ab231722) at 2 µg/ml + Pig spleen lysate.

    Predicted band size: 11 kDa

  • Anti-S100A12/CGRP antibody (ab231722) at 2 µg/ml + Pig lung lysate.

    Predicted band size: 11 kDa

References

ab231722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up