
  • Product name

    Anti-S100A12/CGRP antibody
    See all S100A12/CGRP primary antibodies
  • Description

    Rabbit polyclonal to S100A12/CGRP
  • Host species

  • Tested applications

    Suitable for: IHC-Fr, WB, ELISA, IHC-FoFrmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Fusion protein corresponding to Human S100A12/CGRP.

  • General notes

     This product was previously labelled as S100A12




Our Abpromise guarantee covers the use of ab37657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr 1/2000.
WB 1/1000 - 1/10000. Detects a band of approximately 10.5 kDa (predicted molecular weight: 10.5 kDa).
ELISA 1/2000 - 1/10000.
IHC-FoFr Use at an assay dependent concentration. PubMed: 25964473


  • Function

    Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. Binds calcium, zinc and copper. Presence of zinc increases the affinity for calcium. Plays an important role in the inflammatory response. Interaction with AGER on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators.
  • Tissue specificity

    Monocytes and lymphocytes.
  • Sequence similarities

    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAAF1 antibody
    • CAGC antibody
    • Calcitermin antibody
    • Calcium-binding protein in amniotic fluid 1 antibody
    • Calgranulin C antibody
    • Calgranulin-C antibody
    • Calgranulin-related protein antibody
    • CGRP antibody
    • EN RAGE antibody
    • EN-RAGE antibody
    • ENRAGE antibody
    • Extracellular newly identified RAGE-binding protein antibody
    • migration inhibitory factor-related protein 6 antibody
    • MRP6 antibody
    • Neutrophil S100 protein antibody
    • p6 antibody
    • Protein S100 A12 antibody
    • S100 calcium binding protein A12 antibody
    • S100 calcium-binding protein A12 (calgranulin C) antibody
    • S100 calcium-binding protein A12 antibody
    • S100A12 antibody
    • S10AC_HUMAN antibody
    see all


  • Anti-S100A12/CGRP antibody (ab37657) + 200 ng recombinant human S100A12/CGRP

    anti-rabbit IgG alkalind phosphatase conjugate

    Predicted band size: 10.5 kDa
    Observed band size: 10.5 kDa
    Additional bands at: 21 kDa (possible dimer)

  • Anti-S100A12/CGRP antibody (ab37657) detects macrophage infiltrates expressing S100A12/CGRP in colon tissues from a patient with Crohn’s disease.


This product has been referenced in:

  • Wu DM  et al. S100A9 gene silencing inhibits the release of pro-inflammatory cytokines by blocking the IL-17 signalling pathway in mice with acute pancreatitis. J Cell Mol Med 22:2378-2389 (2018). WB ; Mouse . Read more (PubMed: 29441717) »
  • Haley KP  et al. The Human Antimicrobial Protein Calgranulin C Participates in Control of Helicobacter pylori Growth and Regulation of Virulence. Infect Immun 83:2944-56 (2015). IHC-FoFr ; Human . Read more (PubMed: 25964473) »
See all 6 Publications for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Immunohistochemistry (PFA perfusion fixed frozen sections)
Human Tissue sections (Gastric biopsy)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Universal Decloaker
Gastric biopsy
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 37°C

Dr. Jennifer Gaddy

Verified customer

Submitted Jul 17 2015


Thank you for contacting us.

We do not have this type of clinical data as our products are for in vitro use. A literature search should be able to provide you with this kind of information.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!

Read More


Thank you for your reply and for kindly confirming these details. No problem, I wanted to ensure I had the correct information so I could provide an accurate answer for you. I can confirm the following details regarding these products: ab103393 S100A12 protein: Recombinant full length Human S100A12 (amino acids 2-92) ab37657: The antibody is likely to detect ab103393 S100A12 protein, since the protein seuqence almost completely overlaps with the human S100A12 immunogen sequence for this antibody: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE ab50250 is a monoclonal raised against the whole length protein. I am sorry the epitope for this has not been mapped. However as it has been rasied against whole protein, I would suggest it should detect the full length recombinant protein. I would recommend also to consider that the protein ab103393 has a his tag. There is a small possibility the tag may interfere with antibody binding, and I am sorry we have no data to guarantee that the his tag will not prevent the binding of ab37657 or ab50250. I am sorry we have no other S100A12 proteins without his tag for you to try on this occasion. I hope this information will be helpful to you. Should you have any further questions, please do not hesitate to contact us.

Read More

For licensing inquiries, please contact partnerships@abcam.com

Sign up