Overview

  • Product name

  • Description

    Rabbit polyclonal to S100A14
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human S100A14 aa 1-91. Two N-terminal tags, His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLV TQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEA


    Database link: Q9HCY8

  • Positive control

    • IHC-P: Human skin cancer tissue. WB: Recombinant human S100A14; Pig stomach tissue lysate.
  • General notes

     This product was previously labelled as S100 calcium binding protein A14

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 12 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
  • Tissue specificity

    Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 1 EF-hand domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • BCMP84 antibody
    • Protein S100-A14 antibody
    • S100 calcium binding protein A14 antibody
    • S100 calcium-binding protein A14 antibody
    • S100a14 antibody
    • S100A15 antibody
    • S10AE_HUMAN antibody
    • S114 antibody
    see all

Images

  • Anti-S100A14 antibody (ab233189) at 2 µg/ml + Recombinant human S100A14

    Predicted band size: 12 kDa

  • Anti-S100A14 antibody (ab233189) at 1 µg/ml + Pig stomach tissue lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 12 kDa

  • Formalin-fixed, paraffin-embedded human skin cancer tissue stained for S100A14 using ab233189 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab233189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233189.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up