Overview

  • Product name

  • Description

    Rabbit polyclonal to S100A16
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat S100A16 aa 1-97. Expressed in E.coli. N-terminal tags.
    Sequence:

    MADCYTELEKALVVLVENFYKYVSKHSLVKNKISKSSFRKMLQKELNHML TDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIREQ


    Database link: B0BMX3

  • Positive control

    • WB: Rat stomach lysate; Recombinant rat S100A16 protein. IHC-P: Rat cerebrum, stomach, heart and testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab233211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml.

Target

  • Function

    Calcium-binding protein. Binds one calcium ion per monomer.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Nucleus > nucleolus. Cytoplasm. Primarily nucleolar. Translocates from the nucleolus to the cytoplasm in response to an increase of intracellular calcium levels.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2300002L21Rik antibody
    • AAG13 antibody
    • Aging associated gene 13 protein antibody
    • Aging associated protein 13 antibody
    • Aging-associated gene 13 protein antibody
    • AI325039 antibody
    • AI663996 antibody
    • DT1P1A7 antibody
    • MGC17528 antibody
    • Protein S100 A16 antibody
    • Protein S100-A16 antibody
    • Protein S100-F antibody
    • Protein S100F antibody
    • S100 calcium binding protein A16 antibody
    • S100 calcium-binding protein A16 antibody
    • S100A16 antibody
    • S100F antibody
    • S10AG_HUMAN antibody
    see all

Images

  • Anti-S100A16 antibody (ab233211) at 1 µg/ml + Rat stomach lysate

    Secondary
    HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 0.2 µg/ml
  • Formalin-fixed, paraffin-embedded rat heart tissue stained for S100A16 using ab233211 at 20 µg/ml in immunohistochemical analysis.

    Secondary antibody used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat cerebrum tissue stained for S100A16 using ab233211 at 20 µg/ml in immunohistochemical analysis.

    Secondary antibody used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for S100A16 using ab233211 at 20 µg/ml in immunohistochemical analysis.

    Secondary antibody used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Formalin-fixed, paraffin-embedded rat testis tissue stained for S100A16 using ab233211 at 20 µg/ml in immunohistochemical analysis.

    Secondary antibody used: HRP-Linked Goat Anti-Rabbit IgG Polyclonal at 2 µg/ml. DAB staining.

  • Anti-S100A16 antibody (ab233211) at 2 µg/ml + Recombinant rat S100A16 protein

References

ab233211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up