Overview

  • Product name

    Anti-S100A4 antibody [ABM48F7]
    See all S100A4 primary antibodies
  • Description

    Mouse monoclonal [ABM48F7] to S100A4
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human S100A4 aa 1-101.
    Sequence:

    MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRT DEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRK K


    Database link: P26447

  • Positive control

    • WB: A549 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab228445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 12 kDa.

Target

  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • 18A2 antibody
    • 42A antibody
    • calcium Placental protein antibody
    • Calvasculin antibody
    • CAPL antibody
    • Fibroblast specific protein 1 (FSP1) antibody
    • Fibroblast specific protein 1 antibody
    • Fibroblast specific protein antibody
    • FSP1 antibody
    • Leukemia multidrug resistance associated protein antibody
    • Malignant transformation suppression 1 (MTS1) antibody
    • Malignant transformation suppression 1 antibody
    • Metastasin antibody
    • MTS1 antibody
    • OTTHUMP00000015467 antibody
    • OTTHUMP00000015468 antibody
    • P9KA antibody
    • PEL98 antibody
    • Placental calcium-binding protein antibody
    • Protein Mts1 antibody
    • Protein S100 A4 antibody
    • Protein S100-A4 antibody
    • S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) antibody
    • S100 calcium binding protein A4 antibody
    • S100 calcium-binding protein A4 antibody
    • S100a4 antibody
    • S10A4_HUMAN antibody
    see all

Images

  • All lanes : Anti-S100A4 antibody [ABM48F7] (ab228445) at 1 µg/ml

    Lane 1 : Wild-type A549 whole cell lysate
    Lane 2 : S100A4 knockout A549 whole cell lysate
    Lane 3 : A375 whole cell lysate
    Lane 4 : HeLa whole cell lysate

    Lysates/proteins at 20 µg per lane.

    Predicted band size: 12 kDa
    Observed band size: 12 kDa



    Lanes 1 - 4: Merged signal (red and green). Green - ab228445 observed at 12 kDa. Red - loading control, ab181602, observed at 37 kDa.

    ab228445 was shown to recognize S100A4 in wild-type A549 cells as signal was lost at the expected MW in S100A4 knockout cells. Additional cross-reactive bands were observed in the wild-type and knockout cells. Wild-type and S100A4 knockout samples were subjected to SDS-PAGE. Ab228445 and ab181602 (Rabbit anti-GAPDH loading control) were incubated overnight at 4°C at 1 ug/ml and 1/20000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20000 dilution for 1 hour at room temperature before imaging.

  • Anti-S100A4 antibody [ABM48F7] (ab228445) at 0.5 µg/ml + A549 (human lung carcinoma cell line) cell lysate

    Predicted band size: 12 kDa

References

ab228445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up