Anti-S100A9 antibody (ab203133)

Rabbit polyclonal S100A9 antibody. Validated in IHC and tested in Mouse, Rat, Human. Immunogen corresponding to synthetic peptide.

Overview

  • Product name

  • Description

    Rabbit polyclonal to S100A9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human S100A9 aa 45-95 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    LQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKM H


    Database link: P06702

  • Positive control

    • Human endometrium carcinoma, bladder carcinoma and lung carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab203133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

  • Function

    Calcium-binding protein. Has antimicrobial activity towards bacteria and fungi. Important for resistance to invasion by pathogenic bacteria. Up-regulates transcription of genes that are under the control of NF-kappa-B. Plays a role in the development of endotoxic shock in response to bacterial lipopolysaccharide (LPS) (By similarity). Promotes tubulin polymerization when unphosphorylated. Promotes phagocyte migration and infiltration of granulocytes at sites of wounding. Plays a role as a pro-inflammatory mediator in acute and chronic inflammation and up-regulates the release of IL8 and cell-surface expression of ICAM1. Extracellular calprotectin binds to target cells and promotes apoptosis. Antimicrobial and proapoptotic activity is inhibited by zinc ions.
  • Tissue specificity

    Expressed by macrophages in acutely inflammed tissues and in chronic inflammation. Detected in peripheral blood leukocytes, in neutrophils and granulocytes. Detected at sites of vascular inflammation (at protein level). Also expressed in epithelial cells constitutively or induced during dermatoses.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylated. Phosphorylation inhibits activation of tubulin polymerization.
  • Cellular localization

    Secreted. Cytoplasm. Cytoplasm > cytoskeleton. Cell membrane. Associates with tubulin filaments in activated monocytes. Targeted to the cell surface upon calcium influx. Released from blood leukocytes upon exposure to CSF2/GM-CSF, bacterial lipopolysaccharide (LPS) and during inflammatory processes. Serum levels are high in patients suffering from chronic inflammation.
  • Information by UniProt
  • Database links

  • Alternative names

    • Leukocyte L1 complex heavy chain antibody
    • 60B8AG antibody
    • CAGB antibody
    • Calgranulin B antibody
    • Calgranulin-B antibody
    • Calprotectin L1H subunit antibody
    • CFAG antibody
    • CGLB antibody
    • Cystic fibrosis antigen B antibody
    • L1AG antibody
    • Leukocyte L1 complex heavy chain antibody
    • LIAG antibody
    • MAC387 antibody
    • MIF antibody
    • Migration inhibitory factor related protein 14 antibody
    • Migration inhibitory factor-related protein 14 antibody
    • MRP 14 antibody
    • MRP-14 antibody
    • MRP14 antibody
    • Myeloid-related protein 14 antibody
    • NIF antibody
    • OTTHUMP00000015331 antibody
    • p14 antibody
    • Protein S100-A9 antibody
    • S100 A9 antibody
    • S100 calcium binding protein A9 antibody
    • S100 calcium binding protein A9 calgranulin B antibody
    • S100 calcium-binding protein A9 antibody
    • S100A9 antibody
    • S10A9_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling S100A9 with ab203133 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human bladder carcinoma tissue labeling S100A9 with ab203133 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human endometrium carcinoma tissue labeling S100A9 with ab203133 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up