Overview

  • Product name

    Anti-S100G antibody
  • Description

    Rabbit polyclonal to S100G
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human S100G aa 1-66.
    Sequence:

    MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTL DDLFQELDKNGDGEVS


    Database link: P29377

  • Positive control

    • IHC-P: Human small intestine and gastric cancer tissues. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • CABP 1 antibody
    • CABP antibody
    • CABP1 antibody
    • CABP9K antibody
    • CALB3 antibody
    • Calbindin D9k antibody
    • Calbindin-D9k antibody
    • intestinal antibody
    • Protein S100-G antibody
    • S100 calcium binding protein G antibody
    • S100 calcium-binding protein G antibody
    • S100G antibody
    • S100G_HUMAN antibody
    • Vitamin D-dependent calcium-binding protein antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for S100G using ab234678 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human gastric cancer tissue stained for S100G using ab234678 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for S100G (green) using ab234678 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234678.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up