Overview

  • Product name

  • Description

    Rabbit polyclonal to S100P
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human S100P aa 17-70.
    Sequence:

    RYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGD AQVD


    Database link: P25815

  • Positive control

    • IHC-P: Human pancreatic cancer tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab235917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias.
  • Sequence similarities

    Belongs to the S-100 family.
    Contains 2 EF-hand domains.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with S100PBP in the nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MIG9 antibody
    • Migration inducing gene 9 antibody
    • Protein S100-E antibody
    • Protein S100-P antibody
    • Protein S100P antibody
    • S100 calcium binding protein P antibody
    • S100 calcium-binding protein P antibody
    • S100 P antibody
    • S100E antibody
    • S100P antibody
    • S100P_HUMAN antibody
    see all

Images

  • Paraffin-embedded human pancreatic cancer tissue stained for S100P using ab235917 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for S100P (green) using ab235917 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated AffiniPure Goat Anti-Rabbit IgG (H+L).

References

ab235917 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up