Overview

  • Product name

  • Description

    Rabbit polyclonal to S1P1/EDG1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide corresponding to S1P1/EDG1 aa 303-382.
    Sequence:

    NSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSR SKSDNSSHPQKDEGDNPETIMSSGNVNSSS


    Database link: P21453

  • Positive control

    • HepG2 whole cell lysate, mouse brain tissue
  • General notes

    Keep as concentrated solution.

Properties

Applications

Our Abpromise guarantee covers the use of ab137467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 43 kDa.
IHC-P 1/100 - 1/1000.

Target

  • Function

    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. This inducible epithelial cell G-protein-coupled receptor may be involved in the processes that regulate the differentiation of endothelial cells. Seems to be coupled to the G(i) subclass of heteromeric G proteins.
  • Tissue specificity

    Endothelial cells, and to a lesser extent, in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications

    S1P-induced endothelial cell migration requires the PKB/AKT1-mediated phosphorylation of the third intracellular loop at the Thr-236 residue.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD363 antibody
    • CHEDG 1 antibody
    • CHEDG1 antibody
    • D1S3362 antibody
    • ECGF 1 antibody
    • ECGF1 antibody
    • EDG 1 antibody
    • EDG1 antibody
    • endothelial differentiation G protein coupled receptor 1 antibody
    • Endothelial differentiation G-protein coupled receptor 1 antibody
    • Endothelial differentiation sphingolipid G protein coupled receptor 1 antibody
    • FLJ58121 antibody
    • G protein coupled sphingolipid receptor antibody
    • g protein-coupled receptor edg-1 antibody
    • S1P receptor 1 antibody
    • S1P receptor Edg 1 antibody
    • S1P receptor Edg-1 antibody
    • S1P receptor Edg1 antibody
    • S1P(1) receptor antibody
    • S1P1 antibody
    • s1pr1 antibody
    • S1PR1_HUMAN antibody
    • sphingolipid g-protein-coupled receptor 1 antibody
    • Sphingosine 1 phosphate receptor Edg 1 antibody
    • Sphingosine 1 phosphate receptor EDG1 antibody
    • sphingosine 1- phosphate receptor 1 antibody
    • Sphingosine 1-phosphate receptor 1 antibody
    • Sphingosine 1-phosphate receptor Edg-1 antibody
    • Sphingosine 1phosphate receptor type 1 S1P1 antibody
    see all

Images

  • Anti-S1P1/EDG1 antibody (ab137467) at 1/1000 dilution + HepG2 whole cell lysate at 30 µg

    Predicted band size: 43 kDa



    12% SDS PAGE
  • Immunohistochemical analysis of paraffin embedded mouse brain tissue labelling S1P1/EDG1 with ab137467 at a dilution of 1/500.

References

This product has been referenced in:

  • Christensen PM  et al. Impaired endothelial barrier function in apolipoprotein M-deficient mice is dependent on sphingosine-1-phosphate receptor 1. FASEB J 30:2351-9 (2016). Read more (PubMed: 26956418) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab137467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up