Overview

  • Product name

  • Description

    Rabbit polyclonal to S1PR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human S1PR2 aa 293-353.
    Sequence:

    RDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPT SPTFLEGNTVV


    Database link: O95136

  • Positive control

    • WB: Mouse brain lysate. IHC-P: Human small intestine tissue. ICC/IF: SH-SY5Y cells.
  • General notes

     This product was previously labelled as EDG5

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 39 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AGR16 antibody
    • EDG 5 antibody
    • EDG5 antibody
    • Endothelial Cell Differentiation Gene 5 antibody
    • Endothelial differentiation G protein coupled receptor 5 antibody
    • Endothelial differentiation G-protein coupled receptor 5 antibody
    • Endothelial differentiation sphingolipid G protein coupled receptor 5 antibody
    • Gpcr13 antibody
    • H218 antibody
    • LPb2 antibody
    • Lysophospholipid receptor B2 antibody
    • S1P receptor 2 antibody
    • S1P receptor Edg 5 antibody
    • S1P receptor Edg-5 antibody
    • S1P receptor EDG5 antibody
    • S1P2 antibody
    • S1pr2 antibody
    • S1PR2_HUMAN antibody
    • Sphingosine 1 phosphate receptor Edg 5 antibody
    • Sphingosine 1-phosphate receptor 2 antibody
    • Sphingosine 1-phosphate receptor Edg-5 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for S1PR2 using ab235919 at 1/100 dilution in immunohistochemical analysis.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized SH-SY5Y (human neuroblastoma cell line from bone marrow) cells stained for S1PR2 (green) using ab235919 at 1/200 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated AffiniPure Goat Anti-Rabbit IgG (H+L). Counter stained with DAPI.

  • Anti-S1PR2 antibody (ab235919) at 1/500 dilution + Mouse brain lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 39 kDa

References

ab235919 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235919.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up