Overview

  • Product name

  • Description

    Rabbit polyclonal to S31
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Guinea pig, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human S31 aa 203-291.
    Sequence:

    YRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDP TTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAAR


    Database link: P28566

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human testis, kidney and lung cancer tissues. ICC/IF: HeLa and PC-3 cells.
  • General notes

    Previously labelled as 5HT1E Receptor. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 42 kDa.

Target

  • Relevance

    This is one of the several different receptors for 5-HT, a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. The 5-HT1E receptor is expressed in human cortex, caudate, putamen, and amygdala, as well as in dorsal root ganglia and in coronary artery. ESTs have been isolated from human brain cancer libraries.
  • Cellular localization

    Cell Membrane, Multi-pass membrane protein.
  • Database links

  • Alternative names

    • 5 HT1E antibody
    • 5 hydroxytryptamine (serotonin) receptor 1E antibody
    • 5 hydroxytryptamine (serotonin) receptor 1E G protein coupled antibody
    • 5 hydroxytryptamine 1E receptor antibody
    • 5-HT-1E antibody
    • 5-hydroxytryptamine receptor 1E antibody
    • 5HT1E Receptor antibody
    • HTR1E antibody
    • S31 antibody
    • Serotonin receptor 1E antibody
    see all

Images

  • Anti-S31 antibody (ab236651) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 42 kDa

  • Paraffin-embedded human testis tissue stained for S31 using ab236651 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for S31 using ab236651 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for S31 (green) using ab236651 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for S31 (green) using ab236651 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human lung cancer tissue stained for S31 using ab236651 at 1/100 dilution in immunohistochemical analysis.

References

ab236651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up